KEGG   Mycolicibacterium smegmatis MC2 155: LJ00_01550Help
Entry
LJ00_01550        CDS       T03433                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
msb  Mycolicibacterium smegmatis MC2 155
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AIU05588
UniProt: I7FCZ2
LinkDB All DBs
Position
complement(340411..341895)
Genome map
AA seq 494 aa AA seqDB search
MTQTAPAATAATTNWDKLFIGGQWVEPSSSEIIEVFSPATGEKVGQAPLATKADVDAACA
AARKAFDEGPWPRMTPQEREAVLAKATALIEESADEFKTLLKLETGQPQTIVDMMQYGAA
MSTLQFYASAADKFAWKDIRDGIYGQTLVLKEPVGVVGAVVAWNVPFFLAANKLGPALLA
GCTIVLKPAAETPLTTNLMAQKFLEAGLPEGVLSVVPGGPETGRALTDNPALDKFTFTGS
SAVGKEIGKIAAEKLKPCTLELGGKSAAIILEDADLDSTLPMLLFSGLMNSGQACVGQTR
ILAPRSRYDEVVEKVAAGVAAMQVGVPDDPAAMVGPLISEKQRERVEGYIKKGIEEGARL
VTGGGRPEGLDSGWFVQPTVFADVDNSMTIAQEEIFGPVLVVIPFEDEDDAVRIANDSVY
GLAGSVYTTDHAKGVEIASKVRTGTYGINMYAFDPGAPFGGYKNSGIGRECGPEGIAGYC
ESKSVLLPFGYTPE
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgacacagactgcaccggccgcgaccgcggccacgacgaactgggacaagctgttcatc
ggcggccagtgggtcgagccttcgtcgtcggagatcatcgaggtcttctcgcccgcgacc
ggcgagaaggtcggtcaggcgccgctggcgaccaaggccgacgtcgacgccgcgtgcgcc
gcggcgcgcaaggcgttcgacgaggggccgtggccgcggatgacgccgcaggagcgcgag
gccgtgctggccaaggcgaccgcgctgatcgaggagagcgccgacgagttcaagacgctg
ctcaagctcgagaccggccagccgcagaccatcgtcgacatgatgcagtacggcgcggcg
atgtcgacgctgcagttctacgcctcggcggccgacaagttcgcgtggaaggacatccgc
gacggcatctacggccagacactggtgctcaaggagcccgtcggcgtcgtcggcgccgtc
gtcgcctggaacgtgccgttcttcctggcggccaacaagctgggcccggcgctgctcgcg
ggctgcacgatcgtgctcaagccggccgccgagacaccgctgaccaccaacctcatggca
cagaagttcctcgaggccggcctgcccgagggtgtgctgtcggtggtgcccggcggcccg
gagaccggccgcgcgctgaccgacaacccggcgctcgacaagttcacgttcacgggctcg
agcgcagtgggcaaggagatcggcaagatcgccgccgagaagctcaagccgtgcacgctg
gaactgggcggcaaatccgcggcgatcatcctcgaggacgccgacctggactcgacgctg
ccgatgctgctgttctcgggtctgatgaactccgggcaggcatgtgtcggccagacccgc
atcctggcaccgcgctcgcgttacgacgaggtcgtggagaaggtcgccgcgggtgtcgcc
gcgatgcaggtcggcgtgcccgatgacccggcggcgatggtgggtccgctgatcagcgag
aagcagcgcgaacgcgtcgagggctacatcaagaagggcatcgaggagggcgcgcgtctg
gtgaccggcggcggtcgtcccgagggcctggattccggctggttcgtgcagcccacggtg
ttcgccgacgtcgacaactcgatgaccatcgcgcaggaggagatcttcgggcccgtgctc
gtggtgatccccttcgaggacgaggacgacgccgtgcgcatcgccaacgactcggtgtac
ggcctggccggttcggtgtacaccaccgatcacgccaagggcgtcgagatcgcgtcgaag
gtccgcacgggcacctacggcatcaacatgtacgcattcgatccgggcgccccgttcggc
ggctacaagaactccggcatcggccgcgagtgcgggcccgagggcatcgcgggttactgc
gagtccaagagcgtgctgctgccgttcgggtacacccccgaataa

DBGET integrated database retrieval system