KEGG   Mycolicibacterium smegmatis MC2 155: LJ00_02885Help
Entry
LJ00_02885        CDS       T03433                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
msb  Mycolicibacterium smegmatis MC2 155
Pathway
msb00250  Alanine, aspartate and glutamate metabolism
msb00280  Valine, leucine and isoleucine degradation
msb00310  Lysine degradation
msb00410  beta-Alanine metabolism
msb00640  Propanoate metabolism
msb00650  Butanoate metabolism
msb01100  Metabolic pathways
msb01120  Microbial metabolism in diverse environments
Module
msb_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:msb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    LJ00_02885
   00650 Butanoate metabolism
    LJ00_02885
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LJ00_02885
   00280 Valine, leucine and isoleucine degradation
    LJ00_02885
   00310 Lysine degradation
    LJ00_02885
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LJ00_02885
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:msb01007]
    LJ00_02885
Enzymes [BR:msb01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     LJ00_02885
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     LJ00_02885
    2.6.1.48  5-aminovalerate transaminase
     LJ00_02885
Amino acid related enzymes [BR:msb01007]
 Aminotransferase (transaminase)
  Class III
   LJ00_02885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AIU05850
UniProt: I7FWM6 A0QQ04
LinkDB All DBs
Structure
PDB: 

Position
657682..659028
Genome map
AA seq 448 aa AA seqDB search
MTIAEIAGRTLTQERRLVTAIPGPISQELQARKQSAVAAGVGVTLPVYVVAAGGGVLADA
DGNQLIDFGSGIAVTTVGNSAPAVVDAVTQQVAAFTHTCFMVTPYEGYVKVAEHLNRLTP
GDHEKRTALFNSGAEAVENAVKIARAYTRRQAVVVFDHAYHGRTNLTMAMTAKNQPYKHG
FGPFANEVYRVPTSYPFRDGETDGAAAAAHALDLINKQVGADNVAAVVIEPVHGEGGFVV
PAPGFLGALQKWCTDNGAVFVADEVQTGFARTGALFACEHENVVPDLIVTAKGIAGGLPL
SAVTGRAEIMDGPQSGGLGGTYGGNPLACAAALAVIDTIERENLVARARAIGETMLSRLG
ALAAADPRIGEVRGRGAMIAVELVKPGTTEPDADLTKRVAAAAHAQGLVVLTCGTYGNVL
RFLPPLSMPDHLLDEGLDILAAVFAEVK
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
gtgaccatcgccgagatcgccggtcggacactcacccaggaacgccggctcgtcaccgcc
attcccggcccgatctcgcaggagctgcaggcgcgcaagcagagtgccgtggcggcgggt
gtcggcgtgacgctgccggtctacgtcgtcgcggccggtggcggcgtgctcgcggacgcc
gacggcaaccagctcatcgacttcggctcgggcatcgccgtcaccaccgtcggcaacagc
gcacccgccgtcgtcgacgcggtgacgcagcaggtcgcagcgttcacccacacgtgcttc
atggtcacgccctacgagggatacgtgaaggtggccgagcacctcaaccggctcaccccg
ggcgatcacgagaagcgcacggcgctgttcaactccggcgccgaagccgtcgagaacgcg
gtcaagatcgcgcgtgcctacacccgcaggcaggcggtggtggtgttcgaccacgcctac
cacggccgcaccaacctgaccatggcgatgaccgccaagaaccagccgtacaagcacggc
ttcggcccgttcgccaacgaggtgtaccgcgtgcccacgtcgtacccgttccgcgacggc
gagaccgacggcgcggccgccgcggcgcacgccctcgacctgatcaacaagcaggtcggc
gccgacaacgtcgccgccgtggtgatcgaacccgtccacggtgagggcggatttgtcgtt
cccgcaccgggattcctcggcgctctgcagaagtggtgcaccgacaacggcgcggtgttc
gtcgccgacgaggtgcagaccggattcgcccgcaccggtgcgctgttcgcgtgcgagcac
gagaacgtggtgcccgatctgatcgtcaccgccaagggcatcgcaggcggtctgccgctg
tcggcggtgaccggtcgcgccgagatcatggacggcccgcagtccggtggcctcggcggc
acctacggcggcaacccgctggcgtgtgccgccgcgctcgcggtgatcgacaccatcgag
cgtgaaaacctcgtcgcgcgggcccgcgcgatcggcgagaccatgctgagccgcctcggt
gcgctcgccgcagccgatccgcgcatcggcgaggtgcgtggccgcggcgccatgatcgct
gtcgaactggtcaagccgggcaccaccgagcccgacgccgacctgaccaagcgcgtcgcc
gccgctgcgcacgcgcagggcctggtggtgctgacgtgcggcacctacggcaacgtgctg
cgcttcctgcccccgctgagcatgcccgaccacctgctcgacgaaggactcgacatcctg
gccgcagtgttcgcagaggtgaagtga

DBGET integrated database retrieval system