KEGG   Mycolicibacterium smegmatis MC2 155: LJ00_03930
Entry
LJ00_03930        CDS       T03433                                 

Definition
(GenBank) glycine oxidase
  KO
K03153  glycine oxidase [EC:1.4.3.19]
Organism
msb  Mycolicibacterium smegmatis MC2 155
Pathway
msb00730  Thiamine metabolism
msb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    LJ00_03930
Enzymes [BR:msb01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.19  glycine oxidase
     LJ00_03930
SSDB
Motif
Pfam: DAO Pyr_redox_2 3HCDH_N 2-Hacid_dh_C
Other DBs
NCBI-ProteinID: AIU06055
UniProt: A0QQK8
LinkDB
Position
878157..879161
AA seq 334 aa
MTRTVAVIGGGVIGLSVARRAALDGWTVRLHCTTERGASWVAGGMLAPHSEGWPGEEQLL
QLGLESLRLWHSGFLDGLPEKVVTARESLVVAVDRADAADLRTVAEWLAAQGHPVEFTTA
ARDVEPLLAQGIRHGFRATTELAVDNRGVVDALAAHCERLAVRWAGQVDDLADVDADAVV
IANGIDAPRLWPDLPVRPVKGEVLRLRWRKGCMPVPQRVIRARVHGRQVYLVPRADGVVV
GATQYEHGRDTAPVVSGVRDLLEDACAVMPALGEYELAEIAAGLRPMTPDGLPVVERVDE
RTVVAVGHGRNGFLLAPWTAERVAAELEVGVGAK
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgacacgtacggtcgccgtcatcggcggtggcgtcatcgggctgtccgtcgcgcgacgc
gcagcgctcgacgggtggacggtgcgcctgcactgcaccaccgagcgcggcgcgtcgtgg
gtggccggcggcatgctggcgccccacagcgaaggctggcccggtgaggagcagttgctc
cagctggggctggaatcgctgcggttgtggcactccgggtttctcgacggcctgcccgag
aaggtggtgaccgcgcgggaatcgctcgtggtggcggtggaccgcgccgacgccgccgat
ttgcgcactgttgccgagtggcttgccgcccagggccatccggtcgagttcaccaccgcc
gcccgtgatgtggaacctttgctggctcaaggtattcggcacggattccgcgcgacgaca
gagctggcggtggacaaccgcggggtggtcgacgcgctggccgcgcactgcgagcggttg
gccgtgcggtgggcggggcaggtcgacgacctcgccgatgtcgacgccgacgccgtggtg
atcgccaacggcatcgacgcgccgcggctgtggccggacctgccggtacgcccggtcaag
ggtgaggtgctgcggctgcggtggcgcaagggttgtatgccggtgccgcagcgcgtgatc
cgcgcccgtgtgcacggcaggcaggtgtacctggtgccccgcgccgacggcgtggtggtc
ggtgccacgcagtacgagcacggccgcgacaccgcaccggtggtcagcggcgtgcgggat
ctgctggaggacgcctgcgcggtgatgcccgcgctgggggagtacgaactggccgagatc
gcggccgggctgcggccgatgacgccggacggtttgcccgtcgtggaacgtgtcgacgag
cgcaccgtggtcgccgtcgggcacggacggaacggatttctgttggcgccgtggaccgct
gagcgggtcgcggcagaactcgaagtgggtgtgggagcgaaatga

DBGET integrated database retrieval system