KEGG   Mycobacterium smegmatis MC2 155: LJ00_07860Help
Entry
LJ00_07860        CDS       T03433                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
msb  Mycobacterium smegmatis MC2 155
Pathway
msb00250  Alanine, aspartate and glutamate metabolism
msb00410  beta-Alanine metabolism
msb00430  Taurine and hypotaurine metabolism
msb00650  Butanoate metabolism
msb01100  Metabolic pathways
msb01110  Biosynthesis of secondary metabolites
msb01120  Microbial metabolism in diverse environments
msb02024  Quorum sensing
Module
msb_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:msb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    LJ00_07860
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LJ00_07860
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LJ00_07860
   00430 Taurine and hypotaurine metabolism
    LJ00_07860
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    LJ00_07860
Enzymes [BR:msb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     LJ00_07860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AIU06805
UniProt: A0QSR5
LinkDB All DBs
Position
1664298..1665677
Genome map
AA seq 459 aa AA seqDB search
MSHKQSRGPHVAPAYTGRLAMAPVPSLRLPDEAMDPSAAYRFIHDELMLDGSSRLNLATF
VTTWMDPEAEKLMAETFDKNMIDKDEYPATAAIEARCVSMVADLFHAEDLRDDDPASAVG
VSTIGSSEAVMLAGLAMKWRWRAKAGDWKGRTPNLVMGANVQVVWEKFCRYFDVEPRYLP
MAEGRYVITPEQVLDAVDEDTIGVVAILGTTYTGELEPVAEICEALDKLAAGGGVDVPVH
VDAASGGFVVPFIHPDLVWDFRLPRVVSINVSGHKYGLTYPGVGFVVWRNKEHLPEELVF
RVNYLGGDMPTFTLNFSRPGNQVVGQYYNFLRLGRAGYTQVMQCLSQTARWLGDELRDSE
HFELISDGSAIPVVAFRLKGDPGYTEFDISQALRAHGWQVPAYTMPEGAEDVVVLRVVVR
EGFSADLARALKDDIITVLGQLDALKPRGQFDQLQPFAH
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcacaagcagagtcgcggtccgcacgtcgcgccggcgtacaccggacggttggcc
atggcgcccgtgccgtcgctgcgcctgcccgacgaggccatggatccgtctgcggcgtac
cggttcatccacgacgagttgatgctcgacggcagctcgcggctgaacctcgcgacgttc
gtgacgacgtggatggaccccgaggccgagaagctcatggccgagacgttcgacaagaac
atgatcgacaaggacgagtacccggccaccgcggccatcgaggcccgctgcgtgtcgatg
gtggccgacctgttccacgccgaggatctgcgcgacgacgacccggcgagcgccgtcggg
gtgtcgacgatcgggtccagcgaggccgtgatgctggccgggctggcgatgaaatggcgc
tggcgcgccaaggccggcgactggaaggggcgcacgccgaacctggtgatgggcgccaac
gtccaggtggtgtgggagaagttctgccgctacttcgacgtcgaaccccgctacctgccg
atggcagagggccgctacgtcatcacgcccgagcaggttctcgacgccgtcgacgaggac
accatcggcgtcgtggcgatcctgggcaccacctacaccggcgagctggaaccggtcgcc
gagatctgcgaggcgctggacaagctcgccgcgggcggcggggtggacgtgccggtgcac
gtcgacgcggccagcggcgggttcgtggtgccgttcatccatcccgacctggtgtgggac
ttccggctgccccgcgtggtgtcgatcaacgtcagcggccacaagtacggcctgacgtac
ccgggtgtcgggttcgtggtgtggcgcaacaaagagcacctgcccgaggagctggtgttc
cgggtcaactacctcggcggcgacatgccgacgttcacgctgaacttctcgcggcccggc
aaccaggtggtggggcagtactacaacttcctgcggctggggcgcgccgggtacacccag
gtgatgcagtgcctgtcgcagaccgcccggtggctgggcgacgagctgcgcgacagcgag
cacttcgagctgatctccgacggttcggccatcccggtcgtggcgttccgtctcaagggc
gatcccggatacaccgagttcgacatctcgcaggcactgcgggcgcacggctggcaggtg
cccgcgtacaccatgcccgagggcgccgaagacgtcgtggtgctgcgtgtggtggtccgt
gaggggttctccgccgacctcgcgcgggcgctcaaggacgacatcatcacggtgctgggc
cagctcgacgcgctcaaaccgcgcgggcagttcgaccagctccagcctttcgcgcattag

DBGET integrated database retrieval system