KEGG   Mycolicibacterium smegmatis MC2 155: LJ00_09935Help
Entry
LJ00_09935        CDS       T03433                                 

Definition
(GenBank) acyl-CoA dehydrogenase
Organism
msb  Mycolicibacterium smegmatis MC2 155
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_dh_M Acyl-CoA_dh_2 Vault PucR
Motif
Other DBs
NCBI-ProteinID: AIU07208
UniProt: I7FI16 A0QTW7
LinkDB All DBs
Structure
PDB: 

Position
2073367..2074521
Genome map
AA seq 384 aa AA seqDB search
MALTAEEETIVKTVHDFVEKQVKPVVRELEHANTYPEELIETMKEIGIFGLAIPEPYGFG
AVSMPCYVQVAEELARGWMSLAGAMGGHTVVSKLLLLFGTEEQKQKYLPRMATGELRATM
ALTEPGGGSDLQAMRTVARRDGDDYVINGSKTWISNARRSDLVALMCKTDPDAQPAHKGV
SILLVEKVPGFDVSRDLPKLGYKGVESCELNFTDARVPVSSLLGDDEGRGFAQMMKGLEV
GRLQVAARATGVARAAFEDALRYSQERESFGKPIWQHQSVGNMLADMGTKLYAARSLLLS
AAEKFDAGQRCDMEAGMAKLFASETAMQIALDAVRVHGGYGYSTEYDVERYFRDAPLMIV
GEGTNEIQRNVIAKQLVARGGLDI
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgacggccgaagaggaaaccatcgtcaagacggtgcacgatttcgtcgagaag
caggtcaaaccggtggtacgggagttggagcacgccaacacctatcccgaagagctgatc
gagacgatgaaggagatcggtatcttcgggctcgcgatcccggagccgtacgggttcggg
gcggtgtccatgccgtgttacgtgcaggtcgccgaggaactggccaggggctggatgagc
ctggccggcgcgatgggcggccacaccgtggtgtcgaagctgctgttgctgttcggcacc
gaggagcagaagcagaaatacctgccgcggatggccaccggtgaactgcgcgccacgatg
gcgctcaccgaacccggtggcgggtcggatctgcaggccatgcgcaccgtcgcgcgccgg
gacggcgacgactacgtgatcaacggcagcaagacctggatctccaacgcgcggcgctcg
gatctggtggcgctgatgtgcaagaccgatcccgacgcgcagcccgcacacaagggtgtg
tcgatcctcctggtggagaaggtgcccggcttcgacgtgtcacgcgacctacccaagctg
ggctacaagggcgtggagagctgcgagctcaacttcaccgacgcccgggttccggtctcc
tcgctgctcggcgacgacgagggccgtgggttcgcgcagatgatgaaaggcctggaggtg
ggccggttgcaggtcgcggcgcgggcaacgggcgtggcgcgtgcggcgttcgaggatgcg
ctgcggtactcccaggagcgggagagcttcggcaagccgatctggcaacaccagtcggtc
ggaaacatgttggccgacatgggaaccaagctgtacgcagcgcgctcgctgctgctcagt
gcggccgagaagttcgacgcggggcaacgctgtgacatggaggccggcatggccaagctg
ttcgcgtcggagaccgcgatgcagatcgcactggacgccgtacgcgtgcacgggggctac
ggctattccaccgagtacgacgtcgaacgttacttccgcgatgcgccactgatgatcgtc
ggcgagggcaccaacgagatccagcgcaacgtgatcgccaaacaactcgtcgcgcgcggc
ggtctcgacatctga

DBGET integrated database retrieval system