KEGG   Mycobacterium smegmatis MC2 155: LJ00_11675Help
Entry
LJ00_11675        CDS       T03433                                 

Definition
(GenBank) glycogen synthase
  KO
K16150  glycogen synthase [EC:2.4.1.11]
Organism
msb  Mycobacterium smegmatis MC2 155
Pathway
msb00500  Starch and sucrose metabolism
msb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LJ00_11675
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:msb01003]
    LJ00_11675
Enzymes [BR:msb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     LJ00_11675
Glycosyltransferases [BR:msb01003]
 Polysaccharide
  Storage polysaccharide
   LJ00_11675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4 Glyco_transf_5 Glyco_trans_4_4 Glyco_trans_1_2 Glycogen_syn Glyco_trans_4_2 KR F420_oxidored NmrA
Motif
Other DBs
NCBI-ProteinID: AIU07533
LinkDB All DBs
Position
complement(2428698..2429939)
Genome map
AA seq 413 aa AA seqDB search
MKILMVSWEYPPVVVGGLGRHVHHLATALAAAGHEIVVLSRQPSGTDPSTHPSTDEVREG
VRVVAAAQDPHEFEFGTDMMAWTLAMGHAMIRTGLKVRDSAGNPWVPDLVHAHDWLVAHP
AIALAEFFDVPLVSTIHATEAGRHSGWVSGPISRQVHAIESWLVRESDSLITCSTSMSDE
ITELFGPGLSEIRVIRNGIDAQLWPFARRCPRTGPPRLLYVGRLEYEKGIQDAIAALPRI
RRAHPGTTLTIAGDGTQQDWLVEQARKHKVLKATRFVGRLDHDGLVEALQAADAAVLPSH
YEPFGIVALEAAATGTPLVTSTAGGLGEAVIDGETGMSFAPRDVAGLAAAVRAVLDDPDA
AQRRAVAARERLTSDFDWHTVADETAQVYLAAKRREREPLPRRPIVEHALPDR
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaatcctgatggtgtcgtgggaatacccccccgtggtggtcggcgggctcggccgc
catgtgcaccacctggccacggcgctcgccgcggcgggccacgagatcgtggtgctcagc
cgtcagccgtcgggcaccgatcccagcacgcacccgtcgaccgacgaggtgcgtgaaggc
gtgcgcgtcgtcgcggccgcccaagatccccacgagttcgagttcggcaccgacatgatg
gcgtggacactggcgatgggccacgccatgatccgcaccggtttgaaggtgcgggattcc
gcgggcaatccgtgggtgcccgatctggtgcacgcgcacgactggctggtggcccatccc
gccatcgcgctcgccgaattcttcgatgtgccactggtttccacgatccacgccaccgag
gccggcaggcactcgggctgggtgtcggggccgatcagccgccaggtgcacgcgatcgaa
tcctggctggtgcgcgaatcggactcgctgatcacgtgttcgacctcgatgagcgacgag
atcaccgaactgttcggcccgggactgtcggagatccgggtgatccgcaacgggatcgac
gcacagttgtggccgttcgcgcgcaggtgtccccgcacgggtccgccccggttgctctac
gtcggccggctggagtacgagaagggcatccaggacgcgatcgcggcgctgccgcgcatc
cgccgtgcgcatcccggtacgacgctgaccatcgccggcgacggcacgcaacaggactgg
ctcgtcgagcaggcacgaaagcacaaggtgctcaaggcaacccgtttcgtcggccgtctc
gatcacgacggactcgtggaggcactccaggccgcggacgccgcggtgctgcccagccac
tacgaaccgttcggcatcgtggcactggaagccgccgcgaccggcacgccgctggtgacg
tccaccgcgggcggtctcggcgaggccgtgatcgacggcgagaccggaatgtcgttcgcg
ccgcgcgatgtggcgggcctggcggccgcggtccgcgccgtcctcgacgaccccgacgcc
gcgcagcgccgcgcggtcgccgcacgcgaacgcctcacctccgatttcgactggcacacc
gtggccgacgagaccgcgcaggtgtatctcgcggccaagcgtcgcgaacgtgaaccgctg
ccccggcgcccgatcgtcgaacacgcgctgcccgaccggtaa

DBGET integrated database retrieval system