KEGG   Mycolicibacterium smegmatis MC2 155: LJ00_15085Help
Entry
LJ00_15085        CDS       T03433                                 

Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
msb  Mycolicibacterium smegmatis MC2 155
Pathway
msb00400  Phenylalanine, tyrosine and tryptophan biosynthesis
msb01100  Metabolic pathways
msb01110  Biosynthesis of secondary metabolites
msb01130  Biosynthesis of antibiotics
msb01230  Biosynthesis of amino acids
Module
msb_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:msb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LJ00_15085
Enzymes [BR:msb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     LJ00_15085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA_17 KTI12 AAA_18 Cytidylate_kin2 Mg_chelatase Cytidylate_kin AAA_28 AAA_5 AAA AAA_24 6PF2K AAA_22 MMR_HSR1 Ploopntkinase3 CoaE
Motif
Other DBs
NCBI-ProteinID: AIU08188
UniProt: I7FD55 A0QWR0
LinkDB All DBs
Position
3104035..3104769
Genome map
AA seq 244 aa AA seqDB search
MAPRAVLIGLPGSGKSTIGRRLAKVLDVSMLDTDAVIEETAGRTIADIFATDGEKEFRRI
EEEVIRSALQTHDGVLSLGGGAVTTPGVREALAGHTVVYLEISAAEGVRRTGGSTVRPLL
AGGDRAEKYRKLMAERVPLYRKVATIRINTNRRNPGAVVRTIVARMENPQQAKPVAAART
PKPGKPRRRRRPPWRRTGKNGKNGSAEPKAETAGDSGIASAATTTKVTPTPAALAARNVE
RHND
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgcgggcggtactgatcggcctgcccggttcgggcaagtcgaccatcggccgc
cgcctcgccaaggtgctcgacgtgtcgatgctcgacaccgacgcggtgatcgaggagacc
gccggccgcacgatcgccgacatcttcgccaccgacggtgagaaggagttccggcggatc
gaggaggaagtgatccgctcggcgttgcagacccacgacggcgtgctgtctctcggcggc
ggtgccgtgacgacgccgggcgtgcgtgaagcgctcgccgggcacaccgtggtgtacctg
gagatcagcgccgccgagggggtgcgccgcaccggcgggagcacggtccggcccctgctc
gcgggcggggaccgcgccgagaagtaccgcaagctcatggcggagcgggttccgctgtac
cgcaaggtcgccacgatccgcatcaacaccaaccggcgcaatcccggcgccgtcgtccgc
acgatcgttgcgcggatggagaatccgcagcaggccaaacctgtcgccgcggcacgcacg
cccaagccgggcaaaccgcgccgcaggcgccgtccgccgtggcgccgcacgggcaagaac
ggcaagaacggatccgccgagcccaaggccgaaacggcaggcgattcaggcatcgcgtcg
gcagcgacgacaaccaaggtgacacccacccccgcggccctggccgcccgtaatgtggag
cgacacaatgactga

DBGET integrated database retrieval system