KEGG   Mycolicibacterium smegmatis MC2 155: LJ00_30335Help
Entry
LJ00_30335        CDS       T03433                                 

Definition
(GenBank) 2,5-dioxovalerate dehydrogenase
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
msb  Mycolicibacterium smegmatis MC2 155
Pathway
msb00040  Pentose and glucuronate interconversions
msb00053  Ascorbate and aldarate metabolism
msb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LJ00_30335
   00053 Ascorbate and aldarate metabolism
    LJ00_30335
Enzymes [BR:msb01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     LJ00_30335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AIU11131
UniProt: A0R5B7
LinkDB All DBs
Position
complement(6196608..6198206)
Genome map
AA seq 532 aa AA seqDB search
MTSMVQTTDLTGQMLIAGTPVRGAGREIRGIDPQTGSFLEPAYPYGDTSHVEAACAAAAD
AFGPYRNAPVEQRARFLEAIADNLDSSRDVLVERAHAESGLPVARLTGEVGRTSGQLRLF
AGVLREGSWNQARIDPALPDREPLPRPDIRQRSVPLGPVAVFGASNFPLAFSVAGGDTAS
ALAAGCPVVVKAHDAHPGTSELVGRAIAQAVTATGMPAGTFSLLYGYGPDLGSALVTDPR
IKAVGFTGSRAGGMALVAAAAARPEPIPVYAEMSAINPVFLLRGALSARAADLARAFVGS
LTMGSGQFCTNPGLVIAVDGPDLDAFVAAAAEAVAATAPTPMLTPGIAENFRTGVETLSG
TAELIARGSDENAPAVSCRAALFGSDVPTFLATEALQAEVFGASGVIVRCADDAEMLRVA
AEVEGQLTATVHAEESDHAKAGELLEILELKAGRILFNGWPTGVEVGHAMVHGGPFPSTS
DSRTTSVGARAIERFLRPVCYQNAPKSLLPSAIADGNPDGMWRTVDGQLTKD
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgacatccatggtgcagacaacagacctgaccgggcagatgttgatcgcgggtacgccg
gtgcgcggcgcgggacgggagatccgcggcatcgatccgcagaccggatcgttcctcgaa
cccgcgtacccctacggcgacacctcgcacgtcgaggccgcgtgcgcggccgcggccgat
gcgttcggcccctaccgcaatgcccctgtcgaacagcgcgcccgcttcctcgaggccatc
gcggacaacctcgactcgagccgtgatgtgctcgtcgagcgcgcccacgccgagagcggc
ctgccggtcgcccggctgaccggtgaggtggggcgcacctcgggccaactgcgactgttc
gccggtgtgctgcgcgagggcagctggaaccaggcccgcatcgacccggcccttcccgac
cgggaaccgttgccacggcccgacatccggcagcgcagcgtgccgctcggccccgtcgcg
gtgttcggggcgagcaacttcccactcgcgttctcggtcgccggtggcgacaccgcgtcg
gccctggccgccgggtgccccgtcgtggtcaaggcgcacgacgcacacccgggcacctcc
gagctcgtcggacgcgccatcgcgcaggccgtcaccgccaccgggatgcccgcgggcacg
ttctccctgctgtacgggtacgggccggatctgggcagcgccctggtcaccgatccgcgc
atcaaggccgtgggcttcaccgggtcccgcgcgggcggcatggcgctggtggccgccgcg
gccgcacgtcccgaaccgatccccgtctacgccgagatgagcgccatcaacccggtgttc
ctgctgcgcggtgcgctgtccgcacgcgcagccgatctggcccgcgcgttcgtcggctca
ctcaccatgggctccgggcagttctgcaccaaccccggcctggtcatcgcggtcgacggt
cccgacctcgacgcgttcgtcgcggcggccgccgaggccgtcgcggccacggcgcccacg
cccatgttgacacccggcatcgccgagaacttccgcaccggagtcgagaccctctccggc
acagcggaactcatcgcgcggggatccgacgagaacgcccctgcggtgtcgtgccgtgcc
gcgctgttcggcagcgacgtacccacgttcctggccaccgaggccttgcaggccgaggtg
ttcggcgcctccggcgtgatcgtccggtgtgccgacgacgccgagatgctgcgcgtcgcc
gcagaagtcgaaggccagttgacggccacggtccacgccgaggaatccgaccacgccaag
gccggtgaactgctggagatcctcgagctgaaggcgggccgcatcctgttcaacggctgg
cccaccggcgtcgaggtcggccacgcaatggtgcacggcgggccgttcccgtccacctcc
gattcgcgcaccacctccgtgggagccagggccatcgaacgcttcctgcggccggtctgc
taccagaacgcaccgaaatccctgctgcccagtgccattgcggacggcaaccccgacggg
atgtggcgcaccgtcgacggccaactcaccaaagactga

DBGET integrated database retrieval system