KEGG   Mycobacterium smegmatis MC2 155: LJ00_31150Help
Entry
LJ00_31150        CDS       T03433                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
msb  Mycobacterium smegmatis MC2 155
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: AIU11290
UniProt: I7GFM1
LinkDB All DBs
Structure
PDB: 

Position
complement(6367277..6368326)
Genome map
AA seq 349 aa AA seqDB search
MASAATELDVDGVKVRFTNPDKVYFPKLGKNGTKGKLVEYYLSVASGPMLALLRDRPVHL
QRFPDGIEGEEIYQKRVPQKHPDYLETCVVTFPSGRTADALKITHPSSIIWAAQMGTVTL
HPWQVRCPDTEHPDELRVDLDPQPGTGFKEARTVACDVLKPLLDELGLVGYPKTSGGRGV
HVFLRIKPQWDFIEVRRAGIALAREVERRAPDAVTTSWWKEERGERLFIDYNQNARDRTF
ASAYSVRKTPIATVSMPLSWDELRNADPDDYTMNTVPDLLAGRDDPWADIDSVQQSLGPL
LDLVAADEERGLGDLPYPPNYPKMPGEPPRVQPSKKVAEHWDEQGNRKQ
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atggccagtgcggcaaccgaactcgacgtcgacggggtaaaggtccggttcaccaacccg
gacaaggtgtactttcccaagctcggcaagaacggcaccaagggcaagctcgtcgagtac
tacctgtccgtcgcgtccggccccatgctggcactgttgcgcgaccgcccggtgcacctg
cagcggttccccgacggcatcgagggcgaggagatctaccagaaacgggtgccgcagaag
catcccgattatctggagacctgcgtcgtcacgttcccgtcggggcgcacggccgacgcg
ctgaagatcacgcacccgtcgtcgatcatctgggccgcccagatgggcaccgtcacactg
catccgtggcaggtgcgctgccccgacaccgaacatcccgacgaactgcgcgtcgacctc
gacccgcaacccggcacaggattcaaggaggcccgcaccgttgcgtgtgacgtgctcaaa
ccgctgctcgacgaactcggcctggtgggttatcccaagacctcgggtggccgtggcgtg
cacgtgttcctgcgcatcaaaccgcagtgggacttcatcgaggtgcgccgtgcgggcatc
gcgctggcccgtgaggtcgagcgtcgcgcccccgacgcggtgaccacgtcgtggtggaag
gaagagcgcggcgagcggttgttcatcgactacaaccagaacgcgcgcgaccgcacgttc
gcctcggcctactcggtgcgcaagacccccatcgcgaccgtgtcgatgccgctgagctgg
gacgaactgcgcaacgccgacccggacgactacaccatgaacaccgtgccggatctgctt
gccgggcgcgatgatccgtgggccgacatcgattcggtgcagcagtccctggggccgctg
ctggacctcgtcgccgccgacgaggagcggggcctcggtgatctgccctacccgccgaac
tacccgaagatgcccggcgaaccgccacgggtacagcccagcaagaaggtcgccgagcac
tgggacgagcagggcaaccgcaagcagtga

DBGET integrated database retrieval system