KEGG   Methylocystis sp. SC2: BN69_2322Help
Entry
BN69_2322         CDS       T02324                                 

Definition
(GenBank) Enoyl-(acyl-carrier-protein) reductase (NADH)
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
msc  Methylocystis sp. SC2
Pathway
msc00061  Fatty acid biosynthesis
msc00780  Biotin metabolism
msc01100  Metabolic pathways
msc01130  Biosynthesis of antibiotics
msc01212  Fatty acid metabolism
Module
msc_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:msc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BN69_2322
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BN69_2322
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    BN69_2322
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:msc01004]
    BN69_2322
Enzymes [BR:msc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     BN69_2322
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     BN69_2322
Lipid biosynthesis proteins [BR:msc01004]
 Fatty acid synthase
  Component type
   BN69_2322
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short ADH_zinc_N
Motif
Other DBs
NCBI-ProteinID: CCJ07773
UniProt: J7QQL4
LinkDB All DBs
Position
2388706..2389515
Genome map
AA seq 269 aa AA seqDB search
MTVSTGLMQGKRGLIMGVANDHSIAYGVARVLARHGATLAFTYQGEALGKRVKPLAQELG
SNLVLPCDAEDISTVDQVFARLEHDWGDMDFLVHSIAYSDKSELKGLYADTSRENFIRTL
VISCFSFTEAARRAARLMKNGGSLLTVSFGGGTHVMPNYNVMGVAKAALDSSVRYLAADF
GDRGIRVNALSPGPVRTMAGAGITGARAMGAFQKKHCPLRRMITLDEIGGSALYLLSELS
GGVTGEVHLVDAGYNIMLQPRPEDLNGEE
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgacagtttcaaccggtctcatgcagggtaagcgcggcctcatcatgggcgtcgccaat
gatcattcaatcgcctatggcgtcgcgcgcgttcttgcgcgccacggcgcgacgctcgca
ttcacctatcagggcgaggcgctcggcaagcgcgtcaagccgctcgcgcaggagctcggg
tcgaaccttgtgctgccatgcgacgccgaggatatttcaaccgtggatcaggtgttcgcg
cgtctcgaacacgactggggcgatatggattttctcgtccactccatcgcctattccgac
aaaagcgaattgaagggactctacgccgacacctcgcgcgagaatttcattcgcacgctt
gtcatttcctgtttttccttcaccgaagccgcgcgccgcgccgccaggctgatgaagaat
ggcggatcactgctgacggtgagctttggcggcggcacgcatgtcatgccgaattacaac
gtcatgggcgtcgcgaaggcggcgctcgattcatcggtgcgctatctagcggccgacttc
ggcgatcgcggcattcgcgtcaatgcgctgtcgcccggtccggtgcgcaccatggcgggc
gccggcatcacgggcgcgcgggcgatgggcgcgttccaaaaaaagcattgtccgttgcgt
cggatgatcacgctggatgaaatcggcggttcggcgctttatttgctgtcggagctttcg
ggcggcgtgacgggcgaagtccatcttgtggacgccggctataatatcatgttgcaaccg
cgtcccgaggatctcaacggcgaggagtaa

DBGET integrated database retrieval system