KEGG   Methylocystis sp. SC2: BN69_3230Help
Entry
BN69_3230         CDS       T02324                                 

Definition
(GenBank) Glutathione S-transferase domain
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
msc  Methylocystis sp. SC2
Pathway
msc00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:msc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BN69_3230
Enzymes [BR:msc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BN69_3230
Transporters [BR:msc02000]
 Other Transporters
  Pores ion channels [TC:1]
   BN69_3230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_C_2 GST_N_2 GST_C GST_C_3
Motif
Other DBs
NCBI-ProteinID: CCJ08681
UniProt: J7QIW6
LinkDB All DBs
Position
3333317..3333964
Genome map
AA seq 215 aa AA seqDB search
MNDDNPILYYAPRTRASSVLTLLEELDAPYELRVLNFQLGEQRKPEYLAVNPLGKVPAIV
HNGALVTELGAIFIYLADAFPQKGLAPAIGDALRGPYLRWLAFYGSAFEPAIVDRSMNRA
PAPASRSPYGDFEGVMALINAQLTQGPYLFGERFTGADILWGGALRWTVGFGLVPETPHI
SAYVERVTTRPCFARVAQTDEELLKIHEAAAATSG
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacgacaatccgatcttgtattacgcgccgcgcacgcgggcctctagcgtgttg
accctgcttgaggaactcgacgctccttacgagctgcgcgtgttgaatttccagcttggc
gaacaacgcaagccggaatatctcgccgtcaatccgctcggaaaagtgccggccatcgtt
cacaacggcgcgctcgtgaccgagcttggcgcgattttcatctatcttgccgacgccttt
ccgcagaaaggtctcgcgccagccattggcgacgccttgcgcgggccttatctgcgctgg
ctcgcgttttacgggtcggcgttcgagcctgcgatcgtcgatcgttcgatgaaccgcgcg
ccggcgcctgcgagcagaagtccctacggcgatttcgagggggtcatggcgctgatcaac
gcgcaattgacgcaaggcccctatctcttcggcgagcgcttcaccggcgccgacattctt
tggggcggcgcgctgcggtggacagtcggattcggcctcgtgccggaaaccccgcacatc
tccgcctatgtcgagcgcgtcacaacgcggccctgctttgcgcgcgtcgcgcagaccgac
gaagagctgctcaagattcatgaagcggcggcggcgacgagcggctga

DBGET integrated database retrieval system