KEGG   Myxococcus stipitatus: MYSTI_00935Help
Entry
MYSTI_00935       CDS       T02436                                 

Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
msd  Myxococcus stipitatus
Pathway
msd00380  Tryptophan metabolism
msd01100  Metabolic pathways
Module
msd_M00038  Tryptophan metabolism, tryptophan => kynurenine => 2-aminomuconate
Brite
KEGG Orthology (KO) [BR:msd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    MYSTI_00935
Enzymes [BR:msd01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     MYSTI_00935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AGC42284
UniProt: L7U719
LinkDB All DBs
Position
complement(1158841..1160118)
Genome map
AA seq 425 aa AA seqDB search
MTTHSFEDTEDFARRADEADALRSFRDAFHFPPGTDGKPLVYLAGNSLGLQPKNAARYVQ
EELEDWARFGVEGHHHGRHPWLHYHELVTEQAARLVGAKPQEVVVMNTLTVNLHLMMVSF
YRPTKTRFKILVEGGAFPSDQYAVASQARFHGYDPREAILELKPRPGEETLRTEDILATL
DQHGHEVALVMLGSVNYLTGQAFDIPAITKTAHAKGCFVGFDLAHGAGNLKLALHDDGPD
FAVWCSYKYLNGGPGALAGVFVHERHARSKDIPRFEGWWGHDKATRFQMGPTFDPLPGAE
GWQLSNPPILQLAALRASFELFDQAGMEALRAKSEKLTGYLEFLLEKLPPGFVRIITPRD
VKQRGAQLSLRFKGEAQGMLKRLSDAGIICDFRKPDIIRAAPAPLYCSFTDVYRFVRTLE
AHARD
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgcactccttcgaggacaccgaggacttcgcgcgccgcgccgacgaggccgac
gcgcttcgctccttccgcgacgcgttccacttcccgccggggacggatggcaagccgctg
gtgtacctggcgggcaactcgctggggctccagccgaagaacgccgcgcgctacgtgcag
gaggagctggaggactgggcccgcttcggcgtggagggccaccaccacggacggcacccg
tggctgcactaccacgagctcgtcaccgagcaggccgcgcggctggtgggcgcgaagccg
caggaagtggtggtgatgaacaccctgacggtgaacctgcacctgatgatggtgtcgttc
taccgacccacgaagacgcgcttcaagattctcgtggagggcggagcgttcccctcggac
cagtacgcggtggcgtcgcaggcgcgcttccacgggtatgacccgcgcgaggccatcctg
gagctgaagcctcgcccgggtgaggagacgctgcgcaccgaggacatcctcgccacgctg
gaccagcacgggcacgaagtggccctggtgatgttgggcagcgtgaactacctcacggga
caggcgttcgacatcccggcgattacgaagacggcgcacgccaagggctgcttcgtcggc
ttcgacctggcgcatggcgcgggcaacctgaagctggccttgcatgacgacgggccggac
ttcgcggtgtggtgctcgtacaagtacctcaacggcgggccgggcgcgctggcgggggtg
ttcgtgcacgagcggcatgcgcgctcgaaggacatcccgcgcttcgagggctggtgggga
cacgacaaggcgacgcgcttccagatggggccgacgttcgacccgctgccgggcgcggag
gggtggcagttgtccaacccgcccatcctccagctcgcggcgctgcgggcctcgttcgag
ctgttcgaccaggcgggcatggaggcgctgcgcgcgaagagcgagaagctcaccggctac
ctggagttcctgctggagaagttgcctccgggtttcgtgcgcatcatcacgcccagggac
gtgaagcagcggggcgcgcagttgtcgctgcggttcaagggcgaggcgcaggggatgctc
aagcgcttgtcggacgcgggcatcatctgcgacttccgcaagccggacatcatccgcgcg
gcgcccgcgccgctgtactgctcgttcaccgacgtctaccgcttcgtgcggaccctggag
gcccatgcgcgcgactga

DBGET integrated database retrieval system