KEGG   Myxococcus stipitatus: MYSTI_01773Help
Entry
MYSTI_01773       CDS       T02436                                 

Definition
(GenBank) putative sphingosine-1-phosphate lyase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
msd  Myxococcus stipitatus
Pathway
msd00250  Alanine, aspartate and glutamate metabolism
msd00410  beta-Alanine metabolism
msd00430  Taurine and hypotaurine metabolism
msd00650  Butanoate metabolism
msd01100  Metabolic pathways
msd01110  Biosynthesis of secondary metabolites
msd01120  Microbial metabolism in diverse environments
msd02024  Quorum sensing
Module
msd_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:msd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    MYSTI_01773
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MYSTI_01773
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MYSTI_01773
   00430 Taurine and hypotaurine metabolism
    MYSTI_01773
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    MYSTI_01773
Enzymes [BR:msd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     MYSTI_01773
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AGC43105
UniProt: L7U5I9
LinkDB All DBs
Position
2190228..2191619
Genome map
AA seq 463 aa AA seqDB search
MPLHGKEEVRDRLNDDVYASPDLSVPMPKYRIPDEEHSPDHAYAVVHDELLLDGNSRQNL
ATFCQTWSEPQVHKLMDECLDKNMIDKDEYPQTAEIETRCVNMLADLWHAPHAASTMGCS
TTGSSEAAMLGGLALKWRWRAKRKAEGKSTDKPNLICGPVQICWHKFARYFDVELRQVPL
APGRMVMTPEEVLKRCDENTIGVVPTLGITFNLIYEPVQEIAAALDDLQKRTGLDIPMHV
DAASGGFLAPFIHQDVVWDFTLPRVKSINASGHKFGLTPLGCGWVVWRDKEDLPEELIFR
VDYLGGDMPTFALNFSRPGGQIVIQYYNFLRLGKEGYRRLQQSCSDTANFIAKAIEQIGP
FDIVYDGRGGVPGVCWKMKDGANPGFTLYDLADRMRERGWLVPAYPMPADIHDMVVQRVL
VRHGVSRDLATLLVTDLIACIEHFKRHPVSAPMTREEASGYHH
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgcccctgcacggcaaagaggaagtccgagaccgcctcaacgacgacgtctacgcctcg
ccggacctctccgtcccgatgccgaagtaccgcatccccgacgaggagcacagtccggac
catgcgtatgccgtcgtccacgacgagctgttgctcgacggcaactcgcggcagaacctg
gccaccttctgtcagacctggtccgagcctcaggtgcacaagctcatggacgagtgcctc
gacaagaacatgatcgacaaggacgagtacccgcagaccgcggagattgagacgcggtgc
gtgaacatgctcgcggacttgtggcacgcgcctcacgcggccagcaccatgggctgctcc
acgacgggctccagcgaggcggccatgctggggggcctggcgctcaagtggcgctggcgc
gcgaagcggaaggcggagggcaagtccaccgacaagcccaacctcatctgcggtccggtg
cagatttgctggcacaagttcgcgcgctacttcgacgtggagctgcgccaggtgccgctc
gcgccgggccgcatggtgatgacgcccgaggaggtgctcaagcgctgcgacgagaacacc
atcggcgtcgtgcccacgctgggcatcaccttcaacctcatctacgagcccgtgcaggag
attgccgccgcgctggatgacctccagaagcgcaccggcctggacatccccatgcacgtg
gacgcggccagcggcggcttcctcgcgcccttcatccaccaggacgtcgtctgggacttc
acgctgccgcgcgtgaagtccatcaacgcctccggccacaagttcggcctcaccccgctg
ggctgcggctgggtggtgtggcgcgacaaggaggacctgcccgaggagctcatcttccgc
gtcgactacctgggcggcgacatgccgaccttcgcgctgaacttctcgcggccaggcggg
cagatcgtcatccagtactacaacttcctccggctggggaaggaaggctaccggcgcttg
cagcagtcgtgctcggacaccgcgaacttcatcgcgaaggccatcgagcagattggcccc
ttcgacatcgtctacgacggccggggcggcgtgccgggcgtgtgctggaagatgaaggac
ggcgcgaacccgggcttcacgctctatgacctggccgaccgcatgcgcgagcgcggctgg
ctggtgcccgcgtacccgatgccggcggatatccacgacatggtggtgcagcgcgtgctc
gtgcgccatggcgtcagccgggacctggccacgctgctggtgacggacctcatcgcgtgc
atcgagcacttcaagcggcacccggtgagcgcgcccatgacgcgcgaagaggcgtccggc
taccaccactga

DBGET integrated database retrieval system