KEGG   Myxococcus stipitatus: MYSTI_02092Help
Entry
MYSTI_02092       CDS       T02436                                 

Definition
(GenBank) non-ribosomal peptide synthetase
Organism
msd  Myxococcus stipitatus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Condensation AMP-binding PP-binding AMP-binding_C Thioesterase Abhydrolase_6 Abhydrolase_1
Motif
Other DBs
NCBI-ProteinID: AGC43421
UniProt: L7U3V2
LinkDB All DBs
Position
complement(2610304..2657586)
Genome map
AA seq 15760 aa AA seqDB search
MSGGSKNLDKLTPKQRALYELLLKEKKGQLQDASTQAVERTIPRRTDTQPAPASFPQQRL
WVVDQLEGGRAFAYNVHITVQFTGALDIALLERCVNQVVRRHESLRTVFAAREDGIPVQV
VLPEMHVVVPVEDVSHLSKEEQDAEVERRTSEESQRLFDLARGPLLRGKVLRLSPDTHVA
LVTMHHLVTDRWSLGVFVRELMAFYAAEVAGQSPDLPVPAIQYSDFAVWQRERMQGERLR
TELEFWKKHLRTLPAPLELPTDRPRPPEQTYRGSRQFVTLPVSLTRALKEVSQQEGATLF
MTLLSVFQTLMHRHSRQTDITVGSPIAGRNVPELEQLIGFFVNTLVLRNDLGGNPTFREL
LRRAKDVCMAAYAHQELPFEKLVEELRPPRDLSRHPLFQVMFSFQNTPRQDLSMPGLQST
YLLVDPGSAKFDLLLELREDRPDEIFGWLEYNTDLFDVATVQRMRGHFYSLLGAMAANPD
TRLSELPILTREEQLQLHADFQGAKDDATARDVCLHSLIEEQVRRTPEAEALRFEESSLT
YAQLDARANQLARHLRSLGARPGSLVGVSLERSVDLVVSLLAVLKSGAAYVPLDPAYPRE
RLAGMLEDTQAPVLLTHERLLPALPPSAAQVVCLDTQWDVVAEHSAAALPLLAGADAPAY
VIFTSGSTGRPKGAINAHRGIVNRLLWMQQQYGLTSEDTVLQKTPFSFDVSVWEFFWPLM
TGARLVLARPGGHQDPTYLARLISEARVTTLHFVPSMLRVFLEEPGLESLASLRRVVCSG
EALPAELVRRAHSRLPESAEVHNLYGPTEAAVDVSSWHCARGDARHFVPIGRPVSNTQLH
ILDDAGRPTPVGVPGELFIGGIQVGLGYLSRPSLTAERFIPDAFSSTPGARLYRTGDVAR
WLPDGSIEYIGRADFQVKLRGFRIELGEIEAALLAFPGVSDAVVVLREDASSPRLVGYLV
AAPEVDLQAVRASLAARMPEFMVPSAFVTLPALPLSPNGKVDRKALPAPEQKARDAADYL
EPRTAPQQTLATIWAELLGVPRVGIHDNFFELGGDSILAIQVVSRARQAGLLLAANQLFQ
HQTLEALARVAKQHEGPQAEQGLVLGASLLTPIQLDFFEKALPEPHHFAQAFMLASSEPV
DVPCLEASLRAVVAHHDTLRLRFTRRTDGTWQQEFTGLEAPVRLMQVDLSSVSDAELPSA
LESAGSRLHASHSLEEGLLLRAALFHLGAERGARLLLSVHHLGVDGVSWRTLLEDLGAAY
VQSRQGRPVALPPRSTSFKTWASKLSTFARSEDITRERAYWLEEGQRTVPSLPQDGAGGA
ASVASAGTVEVSLDEAQTRLLLQETPAAWRAHINDVLLTAVADSITGWMGQPRLRVELEG
HGREPFSDDVDLSRTVGWFTTLYPVTLDVSGATSLGERLRSVRDSLRRLPRKGLGHGLLR
HLAEDAQTRTLPRAQVLFNYLGQFNQSAGEGSVLNPFTATREPLGALRAPVAPLSHLLEI
NGYVFEGRLTLVWTYSEAAHRAQTVQSLAERCMTTLRQLIDTRESVDARRFTPTDFPLAR
LSQPELDQVLPSGTLADDLYPLSPLQQGMLFHTVSAPGSGVYVTQLSWLFGGAVDISAFR
RTWEAVIERQPLLRTSFISEGAGEPLQWVHPEATLPWEEHDWRGVAEAAQPGRFDALLSE
DRARGFDLDTPPLLRLTVIRTAENTWRVLWTLHHLIVDGWSLGLLFRELFTTYEQVRSGQ
PVSKSESTSFRDYIAWLQRQSLESAETYWRKALRGFTAPTPLPGARPRHTDAALQRRNLN
LWLPAQTTADLQAFGRQHHLTLNALVQAAWTLVLSRHTGEQDIVFGATTSGRSAEVPGIE
NAVGLFINTLPVRVFVDEDATVLSWLQQLHTQQLELRQFEHTPLSHLQRWSDVPRGTPLF
ESLFIVENFPVDAAVNSASADLGIRDFVAREQADTPLEAYVIPGDSLELRLLFDAARFEP
STPVRLIRHWAAAIQALLASPNARVSSLSLVAGEEREQVLRSFNASSRPFDSSGLHLQFV
AQAARSPDSTALSFGDESLTYGQLLQRVLRISLRLQSLGLRPDSPVGLFLHRSSDMVAAM
LAILHAGGSYLPLDPDYPSDRLSWMLQDSRAPFILTSRSLSGALPSSDAQVLLIEETGTD
SALTPGKADSSNLAYVIYTSGSTGRPKGVMVPHRTAANFFAAMDERLGSSPGTWLAVTSI
SFDISVLELLWTLCRGFHVVLHDERAASRLGTALSLPEVLRRHPVSHLQCTPSFARSRVL
DPDSLSALSSLRFLLVGGEALPGPLSSQLRTALPQSSLLNMYGPTETTVWSSSHTASSSD
DDASTLSIGTPLANNRLFVLDSSGQPSPIGAPGELFISGDGVVRGYLGRPDLTAERFLPD
AFSGVPGARLYRTGDLARWRADGSLDFLGRADFQVKLRGFRIELGEIEAVLSRHPSVLQA
VCGVHLDASGDGRLVSWLVPQPGVSLEPSALREFVQRHLPEHMVPAVFLSLSALPLTPNG
KVDRKALPAPLRPSPQAEVTTDDSEPQTPQEKILAAIWSDALRVPSVKRQDNFFALGGDS
ILSIQIVSRARNAGVQLTTQQLFQHPTLEALARVVKLEGNAWAEQSDSALKALALRTTTD
SKSQSSADLLLGRLKQAVADRLVPVGMPVEDLYPLSPLQQGMLFHTLSAPGSGVYVTQLT
WIFSGAVDLGAFRRTWDAVIQRQPLLRTSFLAGGAQEPLQLVHPSAALPWEELDWRGVEA
SEQQSRFQALLSEDRARGFDLRTPPLLRLTVIRTGEQAWRVLWTTHHVLMDGWSMGLLFQ
DLFNTYEQVRAGLVWVRSEATAFRDYIDWLQRQPMEPAERYWRKTLRGFTAPTPLPGALA
RSSDAVLQRQRLQLHLPAQATAELQSFARQQHLTLNALVQAAWALVFSRHTGERDILFGA
TTSGRSADVSGIERAIGLFINTLPVRILVDEDLTVLSWLQQLHTQQLELRQFEHTPLVRL
HGWSDVPRGTPLFESLFIVENFPVDAAVNASGEALGIRDFTIVDQTDTPLEAYVIPGESL
ELRLLFDAARFEPSAPARLLQHWASALQAIIASPNTRLGALSLVAGEEREQVLRSFNASS
RPFDSSGLHLQFAAQAARSPDSTALSFGDESLTYGQLLQRVLRISLRLQSLGLRPDSPVG
LFLHRSSDMVAAMLAILHAGGSYLPLDPDYPSDRLSWMLQDSRAPFILTSRSLSGALPSS
DAQVLLIEETGTDAALTPGQADSSNLAYVIYTSGSTGRPKGVMVPHRTAANFFAAMDERL
GSSPGTWLAVTSISFDISVLELLWTLCRGFHVVLHDERAASRLGTALSLPEVLRRHPVSH
LQCTPSFARSRVLDPDSLSALSSLRFLLVGGEALPGPLSSQLRTALPQSSLLNMYGPTET
TVWSSSHTASSSDDDASTLSIGTPLANNRLFVLDSSGQPSPIGAPGELFISGDGVVRGYL
GRPDLTAERFLPDAFSGVPGARLYRTGDLARWRADGSLDFLGRADFQVKLRGFRIELGEI
EAVLSRHPSVLQAVCGVHLDASGDGRLVSWLVPQPGVSLEPSALREFVQRHLPEHMVPAV
FLSLSALPLTPNGKVDRKALPAPVLTDSGARYIAPRSPTEEHLAQLFGQVLSVERVGATD
SFFALGGHSLLATQVVSRIHSAMGVELPLRVFFESPTVEQLARRIDASTRAPEPHTAPPL
RPVARSNELPLSFAQQRLWFLDRLEPGSPFYNMPVGLRLEGTLDVSALERAFTELVRRHE
VLRTTFREGPVQVIQPAAPVPLPRVDLSSLPAEEAEAQARRLAREEAQRPFDLTRGPLLR
TTLLRLSESRHILLLTVHHIVSDGWSVDVLVRESAALYAAFREGRPSGLPELPIQYADYA
AWQRGWLQGEALETQLSWWREHLQGAPRFLELPTDFPRPAVQGFQGATLTRTLPRELSES
LQELSRREGTTLFMALLAGFDIVLSRYSGQADLVVGTDIANRNRVETEGLIGFFVNQLAL
RARIEPEMTFRELLAQVRDATLGAYAHQDLPFEELVKAINPERNLAHAPLFQVKLVLQNQ
PAAALEVPGLTLRPEYPESSTSRLDLTLSIVETERGLECTCEYRTGLFESSTIEGLVRHL
GVVLKAAAANPGTPITALSLMAQAEQQQLLVEWNATTRDFPRDAGAHQLFQAQAERTPDA
IAVRFEDQQLTYAQLDARANQLAHHLRGLGIREDVPVALCVERSLDTAVAILGILKAGGA
YVPLDPSYPVERLTFMLRDCAAPVLVTTEAIADELPAGSEQLVLLDAEARFISAQPKHAP
EQSSGADNLAYIIYTSGSTGRPKGTLLQHRGLCNTALQTGHAMGLETGSRVLQFFSAGFD
ASVWEIFGALLSGATLVLAPRERLLPGAPLRTLARDESITAVTLTPSVLAQLSPEDFPSL
RTLVSAGEACTPELVHRWAPHVRFLNAYGPTETTVCASITEPLSAGQPLTIGRPWANLQV
YVVDATMRPQPVGVPGELCVGGVGLARGYLGQPGLTAERFIPDALSGVPGARLYRTGDRA
RWRADGTLEYLGRIDSQVKLRGFRIELGEVEAVLSRLPFVREAVATVREDSPGLTRLVAY
VVAEEDSILEVASLRAALKERLPEHMVPSAIALLPTLPLTAHGKVDRRALPPPEGAGEAD
TREYVAPRTPTEERLAALWRELLHVERVGVHDDFFELGGHSLLATQSLSRVQATFGIELP
LRELFEAPTVERLAARLEALAQTGANTSKVPALTPAPRTGDLPLSFAQQRLWFIDQLEPG
SSLYNIPTALELEGPLDVPALERAFTELHRRHESLRTTFGTVDGQAVQRIQAPAPFQLPI
VALESLAPEKQAHATGQWMSEEAQRPFDLARGPLLRATLLRRAATSHVLLVTMHHSVSDA
WSMSVLVRELVALYEAFRDGRASPLPELAVQYADFAVWQRGWLRDEALAEQLAWWRDALT
GAPALLELPTDRPRAALPSREAALHPVILGAELSEAVKALSQRHGTTPFMTMLAAFQLLL
SRYSGQEDVVVGSPIAGRNRAETEDLIGFFVNTLVLRARIAPSASFADLLSQVKHSTLGA
FEHQDVPFEKLVEELQPQRSLGFSPLFQVTFSLQNAPTGSLELPGLSLRPIAPSGLLAKF
DLDLSLSESASGFEGALQFSTALFDASTAARMATHFLTLLRAAVAQPEVPVTSLALMESD
ERRRLLVEWNDTNADFPHDSPVHLQVSARAALTPHALAVLSDSGSLSFAQLEARSNLLAF
RLVLAGVKPGSLVALFMERSLELPVALLAILKAGAAWLPLDPAYPRERLAFMLQDASPPV
LLTQPHLQAALPPGPTVICLDAQWGAQADADSRLTFTSVPVAASSPAYVIYTSGSSGQPK
GTLVSHQALANHMAWFLSSFPLSSHDRVLLKTPLSFDASVWEVWAPLLSGAPLVLAPPEA
HRDPAALLACVSRHRISVLQLVPSLLRFLLEEAGLSNASHLRFLFCGGEALPSSLARRLH
AALPSTRLVNLYGPTEVTIDSTFSFASPAESRVAIPIGRPVSNTRAYVLDSQLQPVPTGV
PGELFLAGPQLALGYLHRPHLTAERFVPNPFSTEPGARLYRSGDKVRWLSDGSLEYLGRF
DFQVKLRGQRVELGDVEAALLAHADVREAVALVREDSPGHQNLVGYVVAPETADVVAVRA
SLLGRLPEYMVPAVLVRLDALPLTANGKLDRKALPAPDASLTDAYVAPRSATEQTVAHLM
AELLHIERVGAEDSFFALGGHSLLATQLASRIRATFQVELPLRALFELPTVSAFAARIDT
SAREESSARPPLVPLPRSETSPLSFAQQRLWFIDQLEPGSALYNIPTALHLEGALDVAAL
EHAISDVVARHEALRTTFESSSEGQPLQRVHAAAPVTIPRVDLRPLDPTSRSFEEQRLVL
EEATRPFDLTSGPLFRLCLLQLEEDTHLLLFTIHHIISDGWSTGVVVRELGALYAAHLSG
TPAALPALPVQYADYAAWQRGWLRDDALRSELDYWKQHIQGAPALLELPTDRPRPAIQSR
EAALHPVVLGAELSEAVKALSQRHGTTPFMTMLAAFQLLLSRYSGQEDVVVGSPIAGRNR
AETEGLIGFFVNTLVLRARIAPSASFADLLSQVKHSTLGAFEHQDVPFEKLVEELQPQRS
LGFSPLFQVAFSLLNAPSGDLVLPGLELRPLPPSGLLAKFDLDLALSESASGFEGALQFS
TALFDASTAARMATHFLTLLRAAVTQPEVPVSSLPLMESDERRRLLVEWNDTNADFPHDS
PVHLQVSARATLTPHALAVLSDSGSLSFAQLEARSNLLASHLVQAGVKPGSLVALFMERS
LELPVALPSAILKAGAAWLPLDPAYPRERLAFMLQDASPPVLLTQPHLQAALPPGPTVIC
LDAQWGAQADADSRLTFTSVPVAASSPAYVIYTSGSSGQPKGTLVSHQALANHMAWFLSS
FPLSSHDRVLLKTPLSFDASVWEVWAPLLSGAPLVLAPPEAHRDPAALLACVSRHRISVL
QLVPSLLRFLLEEAGLSNASHLRFLFCGGEALPSSLARRLHAALPSTRLVNLYGPTEVTI
DSTFSFASPAESRVAIPIGRPVSNTRAYVLDSQLQPVPTGVPGELFLAGPQLALGYLHRP
HLTAERFVPNPFSTEPGARLYRSGDKVRWLSDGSLEYLGRFDFQVKLRGQRVELGDVEAA
LLAHADVREAVALVREDSPGSQRLVGYFVASQAMDVPALREFLLARLPEHMVPSALVPLT
ALPLTANGKLDRGALPAPDSTTSDSFVAPRNELEQALATVWAQVLRVPRVGIHDNFFQLG
GDSIISLQLVARARRSGLHFTPRQLFQSQTIATLAPVVSRLQAITAEQQPVVGPVLLTPI
QRAFLENPNPAPHHYNQALMLRLREPVGTEALDSALRKLVEHHDALRLRFVQEDGRWSQH
NTPVEHAPSLWREDVSALSESERIARMEAVATQAQSTFDLGTAPLFRAVHFDFGPQESAR
LLLVAHHLVVDAVSWRILVEDLETLCRQARKGEPLSLPAKTTSFKTWSERLHQHARSTAL
DAERAWWLDEARARVLPLPRDRADGANTAASAHTVSLSLDVGDTGLLLREVPAAYRARLQ
DVLLGALGRALALRTGQSRFLVEAEGHGREDLFADVDLSRTVGWFTSLYPVLLQVGTGDS
PGDTVRSTRDALRALPANGLGHGLLRHLRDDDTQARLSALPVPEVSFNYLGQVDVTASDT
SLFTFASEAQGPSMSPRAPRAYVLDVSAVVQGGQLHVSITYSRNLHDEGTVRALLESFGE
ALRLLVANRATADALRYTPADFPLANLTREALDHVLPSGVPVEDVYPLSALQQGMLLHSL
MAPGSGVYVTQFGWTFGARLDLGLFRRAWETVVERHAPLRTTFVWDGLAEPVQVVSPRTV
LPWEELDWRGLPPAEQQSRFSALMASDRVRGFDLRQAPLMRLTVVKLDEGAHRVLWSSHH
LLMDGWSLGLVFKELFALYDAAAKGQRATLGTAPAYRDFISWLREDTTASAEAYWREALQ
GFTTPTPLPGSRLPDTENAPYKQGERGLLLSAETTQALHAYARQHQLTANTVLQGAWALV
LARYSGERDIVFGTTVSGRSTEVAGIEQMVGLFINTLPLRSRLDPDLSVVEWLGSHHAQM
QALHEREHDSLARIQGWSEVPRGQSLFQSLYVFENYPVDDAVYSGGSDFQVRDLASAEQS
DMPFVAIVMPGPRMELRLVYDSQRYQTAVLEQVLHHWNTALEAMLAHPRALVSSLSLLTA
EERERVLVEWNQTDVAYPRDTSVHELFATQAARTPDAIAVASDVGTLTYRELDARANQLA
RHLRTLGVTPGTRVALCLERSLELPVGLLGILKAGAAFVPLDPAYPAERLEAMLAGTAAS
VLVTQERLADELPAYVPLVVCLDSEWDLVARQPPSALAPCADADSLAYVMFTSGSTGQPK
GVAIPHRGITRLVMSGDFIHFGPEEVFLQLAPSSFDASTLELWGALLHGARLVLFPPHTP
TLEELGATLVRHRVTTLWLTAALFEQMAIHQPAALASVRQVLAGGDVLPVRRVREHLSRV
APGSVLVNGYGPTENTTFTACHRMEAGSVIGATVPIGRPISNTRVFVLDERMEPVLPGAP
GELFTGGDGLAWGYLGRPDLTAERFVPHPFAPGERLYRTGDKVRWKDDGTLEFLGRTDFQ
VKVRGFRIEPGEVENVLRLHPSVSEAIVVVREDSPGDKRLVAYVVAPDADVAGMKEFLRQ
KLPEYMVPSALVCLESLPLTPNGKVDRRALPAPELEGASADTFEAPLGATEVALASIFSD
VLGVPRVGRKDDFFELGGHSLLATQVVSRIRATFDLELALRELFESPTLSTLAGQVDALR
LERQGLGLPPLVPVPRTEAMPLSFAQQRLWFIDQLEPASPLYNMPSALRLVGELDVAALE
RAISDVVERHEALRTTFASRDGEPVQHIHPAVPVTLPVVDLGLLPAAERTAEVHRLANAE
SLRPFDLATGPLFRVTLLRVDEAEHVLLSTMHHIVFDGWSTGVLVRELGAYYAAHLSGTQ
AELPPLAVQYADFAAWQRGWLRDEALATRLGYWKRRLEGAPALLELPTDRPRPSIQTRGA
AQQAVVLPADLSHAVKTLSQAHGATPFMTLLAAFQVLLARYSGQDDVVVGSPIAGRNRGE
TEGLIGFFVNTLALRTRLDSRDTFASLLTQVKRTTLEAFDHQDVPFEKLVEELQPERSLS
YSPLFQVMFSVLNTPMGALELPGLRLEGLGDRELPLKFDLDLSLTETPEGFAGTLDYNVD
LFDGATMGRMVEHLLTLLRAAVANPEQPLSALPLMDEAERQRLLVEWNDTAVPVPSDASV
HHQLSAQATRTPEALAVVSDEGSLTYAQLDARSSRLAAHLRSSGVKPGALVALCMERSLE
VPVAVLGVLKAGGAYVPLDPAYPRERLAFMLQDTAAPVLLTQRHLLGVLPPGPAVVCLDA
GWEAELGATTALTDSVPSESAAYVIYTSGSTGQPKGTVLTHRSLSNHAAWMRSTFGLGAG
ERPLLVTSLSFDVSVAELFATLLSGATLVVAPREAHRDPAILAETLVRHDITLLQVVPSL
LRVLLEEPRLRAASNLRRLISGGEALPADLPPRVREVLPHARLDNNYGPTEATIDATTWP
VEPFSGPVAPIGRPMANTQAYVLDAALRPVPTGVPGELYLGGEGLARGYLNRPGITAERF
LPDPFASEPGARLYRTGDKVRWRADGTLDYLGRIDFQVKLRGLRIELGEIEAALLRQPDL
HEAAVLVRDELLVAYVVTRPGLTVDAAQLRQGLLTGLPEYMVPAAFVALPALPLTPNGKL
DRKALPAPDVHASGASEWVAPRTPTEQTLAELMATLLRVERVGAVDNFFTLGGHSLLATQ
LASRIRAAFQVDLPLRALFEEPTVAGLAARIDASRREVSSVPALVPVSREQALPLSFSQR
RLWFIDQLSPGTPLFNLPTALRVEGDLDLAALEQSFRALVSRHEVLRTTFAVQDGEPVQR
ILPAPAFTVPVVDLSALSEEAQQARTRTLVAEDALAPFDLATGPLLRASLLRHGARNHVL
LVTMHHIVSDAWSTGLLVRELAAQYLAHTTGTSAAMSPLPVQYADYAAWQRSWLRGDALQ
QQLDFWRQHLSGAPGALELPTDRPRPAIQSHRGTLLPVELTAELSASVRALAQREGATPF
MVLLAAWQLVLARYAGQDDVSVGFPIANRQQKKTEELIGFFVNTLVLRSRIDARGSFLQL
LAQVRSATLAAYQNQDVPFEKLVEELQPQRDLARSPLFQATLTLQNTPAESTQLPGLTFR
PLTPDLTTSQYELSLLLEEGPQGFVGALNYNTDLFNADTMRRLMRHYATLLGAITTAPER
PVGLLPLMSSEEQHQVLAQWNHTPTEYPREATLPQLFARQAALTPNALAVESETERLTYA
RLESRANQLAHHLRALGVQPGSRVAVYLHRSADLVVALLGILKAGAAYVPLDGSWPTERM
AWVLRQSSAAVLLTESSVADELPELGAVLLVLDEEATRIARRPETAPEVFTSADALAYVM
FTSGSTGQPKGVSVPHRGIVRLVQPHGVIRFGPDETWLQAAPVAFDASTLEIWGALLHGA
RLVIAPPGALSLEELGALLTRHRVSSLWLTAALYEQMVAYQPRALAGVSQVLAGGDVLPS
QRVREHLALLPPGGVLINGYGPTENTTFSATHALRAGDAVGDSVPIGKRVPHSTTFVLDG
ALQPVPPGVTGELYVGGDGLAWGYLERPDLTAERFVPNPFGAPGARLYRTGDKARWLADG
TLEFQGRADFQVKVRGFRIELGEVESALRQHPGASEVIVVVREDAPGDKRLVAYVVPSAQ
GLDAGVLRTFLEERLPAYMVPSAIVMLAELPLTANGKVDRKALPPPGASAPTPELPEAPR
TATEELLAGIYAEVLGVSRLGPRDDFFELGGHSLLATQVVSRIRATFNIELPLRELFEAP
TVAGLARFVESSRQEAQGLAAPPLTAVPRTGALPLSFAQQRLWFIDQLEPGSALYNIPTT
LRLEGTLDITALERAVSDVVARHEALRTTFASIDGQPAQVIHAAAPVTIPLTELQHLPEA
HRQAEARRLAQEEGERAFDLATGPLFRLSLLRLTEREHLLLANVHHIVSDGWSSGVLVRE
LGALYAAHLSGVPAELAPLTVQYADFAAWQRGWLRDETLRTKLAYWKQQLHGAPPLLDLP
TDRPRTEPASRKAANLPLSLGAELSDAVRVLSQQQGATPFMTLLAAFQLLLSRYSGQDDI
SVGSPIAGRNRAETEGLIGFFVNTLVLRTRIDPRTSFRELVDRVRVTTLGAYEHQDVPFE
KLVEELQPERTLGVSPLFQVMFSLLNTPMGGLDLPGLRVHSVDYDDAPAKFDLDLFFNET
ASGYEGALQVSTALFDASTAERMAAHFLTLLRAAVTQPEQPVFTLPLMDTTERYRLVVEW
NDAASSTRAYVLDEFLEPVPVGVPGELFLGGVHHALGYGQGAQLTAERFLPDALSGVSGA
RLYRTGDKVRWRANGALEHLGQVVPRATRRGQRAELDEVEAALRAHPHVEEAAALFREDS
PGKKRLVAYFVPRGALDQTALRTFLRERLSEYLVPTAFVSLPALPRTASGGVDRDALPPH
GATADVQPAWNPPSTPTEKVLAGLMSDLLRVERVGATDSFFSLGGHSLLATQLVSRIRVT
LEVELPLRALFENPTPESLAARIDAVTRAAPLTAPPLVPVSRTGALPLSFAQQRLWFIDQ
LEPGSALYNMPAALRLEGTLDLAALQASFEALVRRHEALRTSFASQDGEPVQVIHASSAF
PLPLVDLSTVATDEHAAQAQRLINEEAVRPFDLATGPLLRASLIRTGEQEHVLLVTMHHI
VSDGWSMEVLVRELVSHYQAIITGTSPVLAPLPVQYADFSAWQRAWLQGDVLQRQLDFWK
QQLSGAPALLELPTDKPRPSVQSSKGGVLPVRLPEDLTQSLESLSQGEGATLFMSLLAAF
QLLLSRYSGQDDISVGSPIAGRNRTETEGLIGFFVNTLVLRSHIDPRDSFRKLLAQVRTT
TLGAYEHQDVPFEKLVEELQPQRSLSHSPLFQVMLALQNTPRGELSLDSGPTALKVTPVD
AEDVSAKFDLSLSLMRTQHGLEGALDFRSELFEERTIARLVEHFVALLKAVVSTPDADLG
SLSLLSDSEREQTLVRWNDTHRELPWEGALHERFATQAARTPDALAVLDDTTSLTFDQLN
CRANKLAHALRAQGIGPESRVALCMERGVDMLVALLGVLKAGGAYVPLDPAHPRERLAFV
LEDSGATLVLTQQLLAERLDVPGVKRLCLDDAAVTREWEDEADTNPTQVTSPEHLAYVIY
TSGSTGMPKGVMIQHASVMNLRAALASTALAGLEGPLRVSLNAPLAFDASVQQLVQLSDG
HTLCIVPQAVRQDAALLVAWADKHQLDVLDCAPSHLRLLLREGLASTRALRVLVGGEAVD
EALWAQLASHPNITAFNVYGPTECTVDSTTRAIRGAVKPSLGAPLANVRAYVLDAQLQPV
PVGVPGELFLSGDGLARGYLSRPALTAERFLPDPFSTIPGARMYRTGDKVCWLPDGALSF
LGRLDFQVKLRGFRIELGEIEATLARHPAVREALVLVREDSPGDQRLVAYYTSLTSPPPE
PSALRAFLAERLPAYEVPNAFVALAEFPLTPNGKVDRGALRPPEAATATEASIAPRTSTE
VRLASLWADVLRLSSVSRNDHFFERGGHSLLATQLMARIRSTFSVELPVRALFESPTLEQ
LALRVERAEASSLPPLLAAAHHGARPLSFAQQRLWFIDQLEPGSALYNMPAALRLEGALH
VSALQASFEALVRRHEALRTSFASHDGEPVQIVHPASAFPLPLVDLSALRTEERAAQAHR
LLNEEAIRAFNLATGPLLRATLLRLGEQEHVLLVTMHHIVSDGWSMDILVRELVTNYQAL
ATGASPAHAPLPMQYADFSAWQRTWLQGDVLQRQLDFWKHQLSGAPALLELPTDKPRPSV
QSSKGGALPLQLPEDVTQTLESLSQGEGATLFMSLLATFQLLLSRYSGQDEISVGSPIAG
RNRTETEGLIGFFVNTLVLRSRINARASFRELLAQVRDTTLGAYEHQDVPFEKLVEELQP
RRSLSHSPLFQVMLTLQNTPLQEQALHSGPTALKVTPVSAEGVSAKFDLSLSLTRTAHGL
SGAITFRSELFEERTIARMAKHFATLLRAVVSAPDAHVGSLSLLSDSEREQLLVRWNDTH
RELPWEGALHERFEAQVARTPDALAALDDSSSLTFDQLNRRANKLAHALRAQRIGPESRV
ALCMERGVDMLVALLGVLKAGGAYVPLDPAHPRERLAFVLEDSGAALVLTQQRLAERLAT
SVVKVLCLDDPRVTESLDREADTALPRVSLPHHLAYVIYTSGSTGMPKGVMIQHASVMNL
RAALASTALAGLEGPLRVSLNAPLAFDSSVKQLVQLADGHTLCVVPQDVRQDTTLLAAWV
EKHQLDVLDCAPSHLRLLLREGLASTRALRVLVGGEAVDEALWAQLASHPRVTAFNVYGP
TECTVDSTARAIRGAVKPSLGAPLANVRAYVLDAQLQPVPVGVPGELFISGDGVARGYLA
RPGLTAERFLPDPFSPIPGARMYRTGDKVCWLPDGELSFLGRIDFQVKLRGFRIELGEIE
ATLARHPSVREALALVREDSSSDSRLVAYFTSRTTPPPEHATLRAFLAERLPAYEVPNAF
VALESFPLTPNGKVDRGALPPPEGTPDADTFIAPQTSTEARLASLWADILRLSSVSRNDH
FFERGGHSLLATQLMARIRSTFSVELPVRALFESPTLEQLALRIERADSAALPPLHSVSR
TGALPLSFAQQRLWFIDQLEPGSPLYNMPAALRLEGTLDQAALQASFDALVQRHEALRTS
FASQDGEPVQVIHASSAFPLPLVDLSALGTEERTAQAQRLINEEAVRPFDLATGPLLRAS
LIRTGEQEHVLLVTMHHIVSDGWSMDVLVRELVSHYQAIITGTSPVLAPLPVQYADFSAW
QRAWLQGDVLQRQLDYWKQQLVGAPAVLELPTDKPRPSVQSSQGGSLPFHLPEELTRALE
SFGQGEGVTLFMSLLASFQLLLSRYSGQDDVSVGSPIAGRRASELEGLIGFFVNTLVLRS
HIDPRDSFRKLLAQVRTTTLGAYEHQDVPFEKLVEELQPQRSLSHSPLFQVMLTLQNTPR
QELELQSGPGALKLTSMGAEGVSAKFDLSLSLLRTQRGLEGSLDFRSELFEERTIARMAE
HFVALVKAVVSTPDADLGSLSFLSDSEREQTLIRWNDTHRELPWEGALHERFATQAALTP
DALAVLDDTTSLTFDQLNRRANKLAHALRAQGIGPESRVALCMERGVDMLVALLGVLEAG
GAYVPLDPAHPRERLAFVLEDSGAALVLTQQSLAERLATSVVKVLCLDDPRVTEALDREA
DTALPRVSLPHHLAYVIYTSGSTGQPKGVMIQHASVMNLRAALASTALAGLAGPLRVSLN
APLAFDASVQQLVQLSDGHTLCIVPQAVRQDAALFVSWVEKHQLDVLDCAPSHLRLLLRE
GLASTRALRVLVGGEAVDEALWAQLASHPRVTAFNVYGPTECTVDSTTRAIRGAVKPSLG
TPLANVRAYVLDAQLQPVPVGVPGELFLSGDGLARGYLSRPALTAERFLPDPFSTISGAR
MYRTGDKVCWLPDGALSFLGRLDFQVKLRGFRIELGEIEATLARHPAVREALVLVREDSP
GDQRLVAYFTSHTTPPPEHAALRTFLAERLPAYEVPNAFVALEAFPLTPNGKVNRGALPP
PETETGTEVFIAPRTTTEARLASLWANVLRLSSVSRNDHFFERGGHSLLATQLMARIRST
FSVELPVRALFESPTLEQLALRVERAEAASLPPLVPVPRTGALPLSFAQQRLWFFEQLQP
GTPTYNMPAALRLVGALDVTALQRAFSELVRRHEVLRTSFHEDNGEPFQVIAPPAPFPLP
VEDLSALDEREDLAWKRAHADATQPFDVSRGPLLRATLLRLAPQEHVLLLNVHHAVSDGW
STSLLIREVTVLYASFQQGRPSPLPELPLQYADYAHWQHQWLTGEVLARQVAWWKNHLSG
APAVLELPTDFPRPALQSFQGRGVGFQLPPALSREVAAFCQQEGVTLFMGLLTAFQVLLS
RYSGQDDISVGSPIAGRRASELESLIGFFVNTLVLRSRIDTAASFRQLLSQVRASTLAAY
EHQDIPFEKLVEELQPQRSLSHSPLFQVMFAFQNTPPATFEAGEGTASPLSFKPFAAEGS
TTHFDLTLSVVETPEGFAGAFTYRTDLFTEATITRMAGHFVTLLEAAVRTPATRVGELPL
LPTAEREQVLTRWNNHRLALPSEGTLHERLEAQVLRTPDALAVFDDHGTASFDGFNRRVN
RLAHWLRSRGVGPEVRVALFLERGVDMLVAVFAVLKAGGAYVPTDVAYPRERLSYILQDC
DARLVLTQSHLAERLEVPEAKVVCMDDAHVTEALERESDVNPARVASAENLAYVIYTSGS
TGRPKGAMVQHGTLMNMRAALMRAVRTDNEGPLRLAINAPLAFDASLLMLVQLTDGHALS
VIPSAERQDSALMLAWLEKHAIDMVEYSPSHLRVLLDEGLAAHRPLRVIVGGDATDEALW
GRLSAHPRLEVFNAYGPTECTVLATCHPIRGAAKPSLGLPLANIQGHVLDARMQPAPLGV
PGELYLGGDGVGRGYLDRPDLTAERFVPDPFSSVPGARLYRTGDQVRRMENGELEYLGRL
DFQVKLRGFRIELGEIEATLGAIAGVHRAVVLAREDRPGDKRLVGYLVTDEGQVMDIAAV
RAALLRSMPEYMVPSAFVFLAALPLDPHGKVDRRALPAPDMASSEAEYVAPRNAGEETVA
SLWSELLGREKVGATDDFFALGGHSLMAVRLMAMLRERTGVALPVSALFQAPTVERLAER
VSQPSQPTSNLVRLDEGASTERPLFLVHGGGGTVLGYAELARALGTERPVYGLSAPGLEG
GELPAPSVEALARDYLTQVRTAQPRGPYLLGGWSFGGLVAHEMARLLQAQGETVELLALF
DSHAPTRKPLAEPDLLTRLMGFGQMLGVSWADLSLDVGRLDGLGVREVLAQVLPALRHSA
PGLSTLGLDMAERLFDVYQRLAEANRVHVPKGVYTGKAVLFRATRAPDEAPVQEDLGWSE
WITGALQVHGAEGDHFTLLSEPRLSSWVGQLAQALEDAAS
NT seq 47283 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcggaagcaagaatctcgacaagctcaccccgaagcagcgcgcgctgtatgag
ctcctcctcaaggagaagaaggggcagctccaggacgcgtcgacccaggcggtggagcgg
accattccgcgccgcaccgacacgcagcccgcacccgcgtcattcccgcagcagcgactg
tgggtggtggaccagctcgagggcggccgcgccttcgcgtacaacgtccacatcaccgtc
cagttcaccggcgcgttggatatcgccctgctggaacggtgcgtgaaccaggtggtgcgg
cgccatgagtcgctgcgcacggtgttcgccgcgcgtgaggacggcatccccgtgcaggtg
gtgttgccggagatgcacgtcgtggtccccgtggaggacgtctcgcacctctcgaaggag
gagcaggacgccgaggtggagcggcggaccagcgaggagtcccagcgcctgttcgacctg
gcgcgcgggcccttgctgcgtggcaaggtgctgcgcctgagccccgacacccacgtggcc
ctcgtcaccatgcatcacctggtgacggaccgctggtcgctgggcgtgttcgtccgcgag
ctgatggccttctacgccgcggaggtcgccggccagtcgcccgacctgcccgtgcccgcc
atccagtactccgacttcgccgtctggcagcgcgagcgtatgcagggcgagcggctgcgc
acggagctggagttctggaagaagcacctgcgcacgctgcccgcgcccctggagctgccc
acggacaggccccgtccgcccgagcagacctaccgaggctcccgccagttcgtcaccctc
ccggtgtcgctcacgcgcgcgctcaaggaggtcagccagcaggagggcgcgacgctcttc
atgacgctgctgtccgtcttccagacgttgatgcaccggcactcgcggcagacggacatc
accgtcggctcgcccatcgctggacgcaacgtgccggagctggagcagctcatcggcttc
ttcgtcaacacgctggtgctgcgcaacgatttgggcggcaaccccaccttccgcgagctg
ctgcgccgcgcgaaggacgtgtgcatggcggcgtacgcgcaccaggagcttccgttcgag
aagctggtggaggagctgcgcccgccgcgcgacttgagccgtcacccgctcttccaggtg
atgttcagcttccagaacacgccccggcaggacctgtcgatgccggggttgcagtccacg
tacctgctcgtggacccgggctccgccaagttcgacctgctcctggagctgcgcgaggac
cggccggacgagatcttcggttggctcgagtacaacaccgacctgttcgacgtcgcgacc
gtccagcggatgcgcgggcacttctactcgctgctcggcgcgatggcggcaaacccggac
acgcggctgtccgagctgcccatcctcacgcgggaagagcagctccagctccacgccgac
ttccagggcgcgaaggacgatgccacggcgcgcgacgtgtgcctgcactcgctcatcgag
gagcaggtccgccggactccggaggcggaggcgcttcgcttcgaggagtcctccctcacg
tacgcgcagctcgatgctcgcgcgaatcagctcgcccgccacctgcgctcgctgggggct
cgtccgggctcgctcgtgggagtttcactcgagcgctccgtcgacctcgtcgtctcactg
ctcgccgtcctcaagtccggtgcggcctacgtcccgctcgaccccgcgtacccgcgcgag
cgcctcgcgggcatgctcgaggacacccaggcccccgtcctcctcacccacgagcgcctc
cttcccgcgcttccgccctcagccgcgcaggtcgtctgcctcgacacgcagtgggacgtg
gtcgccgagcactccgccgcggcgctgccgctcctggccggagccgatgcgcccgcctac
gtcatcttcacgtccggctccacgggccgtcccaagggggccatcaacgcccaccggggc
atcgtcaaccgcctcctctggatgcagcagcagtatgggctgacgtccgaggacaccgtc
ctccagaagacgccgttctccttcgacgtctccgtctgggagttcttctggccgctcatg
acgggcgcgcgactcgtcctcgccaggcctggtggacaccaggacccgacgtacctggcc
cgcctcatctccgaggcacgcgtcaccacgctgcacttcgtcccctccatgctccgcgtg
ttcctcgaggagccgggcctggagtccctcgcgtcgctccgccgcgtcgtgtgcagtggt
gaggcgcttcccgcggagctcgttcgccgcgcgcactcgcgcctgccggagtccgccgag
gtccacaacctctacggccccaccgaggccgccgtcgacgtctcctcctggcactgcgcc
cggggcgacgcccgccacttcgtccccatcggccgccccgtctccaacacccagctccac
atcctcgacgacgcgggccgccccacgcctgtcggtgtcccgggagagctcttcatcggc
ggcatccaggtgggcctcggctacctcagccgcccctcgctcaccgccgagcggttcatc
ccagacgccttctccagcactccgggcgcgcgcctctaccgaaccggcgacgtcgcacgc
tggctgccggatggctccatcgaatacatcggtcgcgccgacttccaggtgaagctgcgg
ggcttccgcatcgagctcggtgaaatcgaagcagcgctcctcgccttcccgggtgtctcc
gacgccgtcgtcgtgctgcgcgaggatgcgtcctcgccgcgcctcgtgggctacctcgtc
gccgcccccgaggtcgacctccaggccgtgcgcgcctccctcgccgcgcgcatgcccgag
ttcatggtgccgtcggccttcgtgacgctgcccgccctgccgctgtctcccaacggcaag
gtcgacaggaaggcgctgcccgctccggagcagaaggcgcgcgacgcggcggactacctc
gagcccaggaccgcgccgcagcagaccctggccaccatctgggccgagctcctgggtgtg
ccgcgcgtcggcatccacgacaacttcttcgagctgggcggcgactccatcctcgccatc
caggtcgtctctcgcgcgcgccaggccggcctgctcctggccgccaaccagctcttccag
catcagacgctggaagccctcgctcgcgtcgcgaagcagcacgaggggccgcaagcggag
cagggattggtgctcggcgcctcgctgctcacgcccatccagctcgacttcttcgagaag
gccctgccggagccgcaccacttcgcgcaggcgttcatgctcgcttcgagcgagcccgtg
gacgtcccgtgcctggaggcctcgctgcgcgcggtggtcgcgcatcacgacacgctgcgg
cttcgcttcacgcgccggacggacggcacctggcagcaggagttcaccggcctggaggcc
cccgtccgcctgatgcaggtggacctctcctccgtgtccgacgcggagctgccctcggcc
ctcgagtccgcgggctcccgcctccatgcgagccactcgctggaggaagggctgctcttg
cgcgccgccctcttccacctcggtgccgagcggggcgctcgcctcctgctgtccgtgcac
cacctcggcgtggacggcgtctcgtggcgcacgctcctggaggacctgggcgcggcctac
gtgcagtcgcggcagggccgtccggtggcactgcctcccaggtccacgtcgttcaagacg
tgggcgtcgaagctgagcaccttcgctcgctccgaggacatcacccgcgagcgggcctac
tggctcgaagagggccagcgcacggtcccttccctcccccaggacggcgcggggggcgcg
gcctccgtggcatccgccggcacggtggaggtctccctggacgaggcccagacccggctg
ctgttgcaggagacgcccgcggcctggcgtgcccacatcaacgacgtgttgctgacggcg
gtggccgacagcatcacgggctggatgggccagccgcgcctgcgtgtcgagttggagggc
cacggtcgagagccgttctccgacgacgtggacctgtcccgcaccgtgggctggttcacc
acgctgtacccggtgacgttggatgtctcgggcgccaccagcctgggtgagcggctgcgc
tcggtgagggactcgctgcggcggcttcctcggaagggcctgggccatgggctgttgcgc
cacctggcggaggatgcccagacgcgcacgctccctcgtgcacaggtgctcttcaactac
ctgggccagttcaaccagtccgcgggcgaaggctcggtgctcaacccgttcaccgcgacg
cgcgagcccctgggtgccctgcgtgctcccgtggccccgctctcccacctgctggagatc
aacggctacgtcttcgagggccggctgacgctggtctggacgtacagcgaggccgctcac
cgggcgcagaccgtccagtccctggccgagcggtgcatgaccacgctgcggcaactcatc
gacacgcgtgagtccgtcgacgctcgccgcttcacgcccacggacttcccgctggcgagg
ctgtcgcagcccgagctcgaccaggtgctgccctcggggaccctcgcggacgacctctat
ccgctgtcgcccttgcagcagggcatgctcttccacaccgtctccgcgccgggctccggc
gtgtatgtcacgcagctgtcgtggctcttcggcggcgccgtggacatctccgccttccgc
cgcacgtgggaggccgtcatcgagcggcagcccttgctgcgcacgtccttcatctcggaa
ggcgccggtgagcccctccagtgggtccacccggaggccacccttccatgggaggagcac
gactggcgcggcgtggcggaggccgcgcagccgggccgcttcgacgcgctcctctccgag
gaccgcgcccgtggcttcgacctggacacgccgccgctgctgcgcctcacggtcatccgc
acggcggagaacacgtggcgcgtcttgtggacgctgcaccacctcatcgtggatggatgg
agcctcgggcttctcttccgcgagctcttcaccacctacgagcaggtgcgctccgggcag
cccgtatccaagagcgagtccacctccttccgcgactacatcgcctggctccagcggcag
tcgctggagtccgcggagacctattggcgcaaggcgctgcgaggcttcaccgcgcccacc
ccgctgcccggcgcgcgtcctcgccacacggatgcggcgctccagcggcggaacctgaac
ctctggctgcccgcgcagaccaccgcggacctccaggccttcggccgccagcaccacctc
accctcaatgcgctggtccaggccgcttggaccctggtgctctcacgccacacgggtgag
caggacatcgtcttcggagccaccacgtcgggccgctcggcggaggtccccggcatcgag
aacgccgtcggcctcttcatcaacacgctgccggtccgcgtcttcgtcgacgaggacgcc
accgtcctctcctggctccagcagctccacacgcagcagctcgagctgcgccagttcgag
cacacgccgctgtcccacctccagcgctggagcgacgtgccgcgtggcacgccgctcttc
gagtcgctcttcatcgtcgagaacttccccgtcgacgccgccgtcaactcggccagcgcg
gacctgggcatccgggacttcgtcgcacgggagcaggcggatacgccgctggaggcgtat
gtcattcctggagactcgctggagctgcggctgctcttcgacgccgcgcgcttcgagccc
tccacgcccgttcgcctcatccgccactgggccgcggccatccaggcgctgctcgcgtcc
ccgaacgcgcgcgtctcttctctctcgctggtggcgggcgaggagcgcgagcaggtcctc
cgctccttcaacgcctcctcacgtcccttcgactcctcgggcctccacctccagttcgtc
gctcaggccgcgcgctcccccgactccaccgccctctccttcggcgacgagtccctcacc
tatggacagctcctccagcgcgtcctccgcatctccctccgactccagtctctcggcctc
cgccctgactctcccgtcggcctcttcctccaccgctcctccgacatggtcgccgccatg
ctcgccattcttcacgcgggcggctcctaccttcccctcgaccccgactacccctccgac
cgcctctcctggatgctccaggactctcgcgctcccttcatcctcacctcccgctctctc
tccggcgcactcccctcctccgacgcccaggtcctcctcatcgaggagaccggcaccgac
tcagccctgactccgggcaaggccgactcctccaacctcgcctacgtcatctacacctcc
ggctccaccggcaggcccaagggcgtcatggtgcctcaccgcaccgccgccaacttcttc
gccgccatggacgagcgcctcggctcctcccccggcacctggctcgccgtcacctccatc
tccttcgacatctccgtcctcgagctcctctggactctctgccgcggattccatgtcgtc
ctccacgacgagcgcgccgcctctcgcctcggcaccgctctctcactccccgaagtcctc
cgccgtcaccccgtctctcatctccagtgcaccccctccttcgctcgctccagggtgctc
gacccagactccctctccgccctctcctccctccgcttcctcctcgttggcggtgaggcc
ctcccaggtcctctctcttctcagctcaggaccgctctccctcagtcctctcttctcaac
atgtacggcccgacggagaccaccgtctggtcctcgtctcacaccgcttcctcctccgac
gacgacgcgtccaccctctccatcggcacgcctctcgccaacaaccgcctcttcgtcctc
gactcctccggacagccctctcccatcggcgctcccggcgagctcttcatctccggcgac
ggcgtcgtccgtggctacctcggacgccccgacctcaccgcggagcgcttcctccctgac
gccttctccggtgtcccgggcgctcgcctctatcgcaccggtgacctcgctcgctggcgc
gcggatggctcgctcgacttcctcggccgcgccgacttccaggtgaagctgcggggcttc
cgcatcgagctcggtgaaatcgaagccgtcctctcacgccacccgtccgtcctccaggcc
gtctgcggcgtccacctcgacgcctccggtgacggccgtctcgtctcctggctcgtcccc
cagcccggtgtctccctcgagccctccgcgctccgcgagttcgtccaacggcacctgccc
gagcacatggtgccggcggtcttcctctcgctctcggcgctgcctctcactcccaacggc
aaggtcgaccgcaaggcgctccccgcgccgctgcgcccgagcccgcaggccgaggtcacc
accgacgactccgagccgcagactccccaggagaagatcctcgcggccatctggtccgac
gccctgcgcgtgccgagcgtcaagcgccaggacaacttcttcgcgttgggtggcgactcc
atcctctccatccagattgtctcgcgcgctcgcaacgccggggtccagctcacgacacag
cagctcttccagcaccccacgctggaggccctcgcccgggtcgtgaagctcgagggcaac
gcctgggcggaacagtcggactccgcgctgaaggcgctggccctgcgcaccacgaccgac
tcgaagagtcagtcgtccgcggacctcctcctcggccggctgaagcaagccgtcgcggac
cgactggtccccgtgggcatgcccgtggaggacctctatccgctgtcgcccttgcagcag
ggcatgctcttccacaccctctccgcgccgggctccggcgtctacgtcacccagctgacg
tggatcttcagtggcgccgtggacctgggtgccttccgccgcacctgggatgccgtcatc
cagcgacagccgttgctgcgcacctcgttcctcgcgggcggcgcgcaggagcccctccag
ctcgtccacccctcggcggccctgccttgggaggagctcgactggcgcggagtggaggcg
tcggagcagcagtcccgcttccaggccctcctctccgaggaccgcgcgcgcggcttcgac
ctgcgcacgccgccactgctgcgcctgaccgtcatccgcaccggtgagcaagcgtggcgg
gtcctctggaccacgcaccacgtgttgatggacggctggagcatgggcctcctcttccag
gacctcttcaacacctacgagcaggtgcgtgcgggcctggtctgggtccggagtgaagcg
acggccttccgcgactacatcgactggctccagcgccagcccatggagcccgcggagcgc
tactggcgaaagacgctgcgaggcttcaccgcgcccacgccgctgccgggagccctggcg
cggagctcggacgccgtgctccagcggcagcgcctccagctccacctgcccgcgcaggcc
acggcggagctccagtccttcgcccggcagcagcacctcacgctcaacgcactggtccag
gccgcatgggccctggtgttctcgcgtcacacgggtgagcgggacatcctcttcggcgcc
accacctccggccgctcggccgacgtctcgggcatcgagcgcgccatcggcctcttcatc
aacacgctgccggtccgcatcctcgtcgacgaagacctcaccgtcctctcctggctccag
cagctccacacgcagcagctcgagctgcgccagttcgagcacacgcccctcgttcgtctg
cacgggtggagcgacgtgccgcgtgggacgccgctcttcgagtcgctcttcatcgtcgag
aacttccccgtcgacgccgcggtgaacgcatccggcgaggctctgggcatccgggacttc
accatcgtcgaccagacggacaccccgctggaggcgtatgtcattcccggggagtcactg
gagctgcggctgctcttcgacgccgcgcgcttcgagccctccgctcccgcgcgtctcctc
caacactgggcctcggcgctccaggcgatcatcgccagtccgaacactcgactgggagca
ctctcgctggtggcgggtgaggagcgtgagcaggtcctccgctccttcaacgcctcctca
cgccccttcgactcctcgggcctccacctccagttcgccgctcaggccgcgcgctccccc
gactccaccgccctctccttcggcgacgagtccctcacctatggacagctcctccagcgc
gtcctccgcatctccctccgactccagtctctcggcctccgccccgactctcccgtcggc
ctcttcctccaccgctcctccgacatggtcgccgccatgctcgccattctccacgcgggc
ggctcctaccttcccctcgaccccgactacccctccgaccgcctctcctggatgctccag
gactctcgcgctcccttcatcctcacctcccgctctctctccggcgcactcccctcctcc
gacgcccaggtcctcctcatcgaggagaccggcaccgacgcagccctgactccgggccag
gccgactcctccaacctcgcctacgtcatctacacctccggctccaccggcaggcccaag
ggcgtcatggtgcctcaccgcaccgccgccaacttcttcgccgccatggacgagcgcctc
ggctcctcccccggcacctggctcgccgtcacctccatctccttcgacatctccgtcctc
gagctcctctggactctctgccgcggattccatgtcgtcctccacgacgagcgcgccgcc
tctcgcctcggcaccgctctctcactccccgaagtcctccgccgtcaccccgtctctcat
ctccagtgcaccccctccttcgctcgctccagggtgctcgacccagactccctctccgcc
ctctcctccctccgcttcctcctcgttggcggtgaggccctcccaggtcctctctcttct
cagctcaggaccgctctccctcagtcctctcttctcaacatgtacggcccgacggagacc
accgtctggtcctcgtctcacaccgcttcctcctccgacgacgacgcgtccaccctctcc
atcggcacgcctctcgccaacaaccgcctcttcgtcctcgactcctccggacagccctct
cccatcggcgctcccggcgagctcttcatctccggcgacggcgtcgtccgtggctacctc
ggacgccccgacctcaccgcggagcgcttcctccctgacgccttctccggtgtcccgggc
gctcgcctctaccgcactggtgacctcgctcgctggcgcgcggatggctcgctcgacttc
ctcggccgcgccgacttccaggtgaagctgcggggcttccgcatcgagctcggtgaaatc
gaggccgtcctctcacgccacccgtccgtcctccaggctgtctgcggcgtccacctcgac
gcctcgggtgatgggcgcctcgtctcctggctcgtcccccagcccggtgtctccctcgag
ccctccgcgctccgcgagttcgtccagcggcacctgcccgagcacatggtgccggcggtc
ttcctctcgctctcggcgctgcctctcactcccaacggcaaggtcgaccgcaaggcgctc
ccggcgccggtgctgacggactcgggggctcgctacatcgcgcctcgctctccgaccgag
gaacacctcgcgcagctgttcggccaggtgctgagcgtggagcgcgtgggagccacggac
agcttcttcgcgctcggcggtcactcgctgctcgccacgcaggtcgtctctcgcatccac
tccgccatgggcgtggagctcccgcttcgcgtcttcttcgagtcgccgaccgtcgagcag
ctcgcgcgccgcatcgacgcctccacgcgggcacccgagccacacaccgcgccgccgctc
cggcccgtcgcccgctcgaatgagctgccgctgtcgttcgcccagcagcgcctctggttc
ttggatcgcctcgagccgggcagcccgttctacaacatgcccgtgggcctccgactggag
gggacgctcgacgtctccgcgctggagcgtgccttcaccgagctggtgcgccggcacgaa
gtcctccgcaccaccttccgcgaaggacccgtccaggtcatccagcccgcggctccagtt
ccgctgccccgcgtggacctctcctcgctccccgccgaagaagcggaagcccaggcccga
cgcctcgcgcgggaggaagcccagcgcccgttcgacctcacccgaggccccctgctgcgc
accacgctgctgcggctgtccgagtcgcggcacatcctgctgctgaccgtgcaccacatc
gtctcggacggctggtccgtcgatgtgctggtgcgtgagtccgccgcgctctacgccgcc
ttccgcgagggtcgcccctccggtctgcccgagctgcccatccagtacgcggactacgcg
gcctggcagcgcggctggctccagggcgaagcactcgagacgcagctctcctggtggcgc
gagcacctccagggcgcgccgcgcttcctcgagctccccacggacttcccccgtcccgcg
gtccagggcttccagggcgccaccctcactcgcacgctgccacgcgagctgagcgagtcc
ctccaggagctctcccgccgtgagggcaccaccctcttcatggcgctgctcgcgggcttc
gacatcgtcctgtcgcgctactcgggacaggccgacctcgtcgtcggcacggacatcgcc
aaccgcaaccgcgtggagacggagggcctcatcggcttcttcgtgaaccagctcgccctg
cgcgcgcgcatcgagccggagatgacgttccgcgagctgctcgctcaggtccgcgacgcc
acgctcggcgcctacgcgcatcaggacctgccgttcgaggagctggtcaaggccatcaac
cccgagcgcaacctcgcgcatgccccgctgttccaggtgaagctggtgctgcagaaccag
cccgccgccgcgctggaggtccccggcctcacgctgcgccccgagtatccggagtccagc
acctcgcgcctggacctcacgctctccatcgtcgagacggagcgcgggctggagtgcacc
tgcgagtaccgcacgggcctcttcgagtcctccaccatcgaggggctcgtgcgccacctc
ggcgtggtgctgaaggccgccgcggcgaaccccggcacgcccatcaccgccctgtccctc
atggcccaggcggagcagcaacagctcctcgtcgagtggaacgccaccacgcgcgacttc
ccgcgcgacgccggtgcgcaccagctcttccaggcccaggccgagcgcaccccggacgcc
atcgccgtgcgcttcgaggaccagcagctcacctacgcgcagctcgatgctcgcgccaac
cagctcgcgcaccacctgcggggacttggcatccgcgaggacgtgcccgtcgccctctgc
gtcgagcgctcgctcgacaccgccgtcgccatcctcggcatcctcaaggcgggcggcgcc
tacgtcccgctcgaccccagctatccggtcgagcgcctcaccttcatgctgcgcgactgc
gccgcgccggtcctcgtcaccaccgaggccatcgccgatgagctccccgccgggagcgag
cagctcgtcctgctcgacgcggaggcgcgcttcatcagcgcccagccgaagcacgctccc
gagcagtcctcgggcgcggacaacctcgcgtacatcatctacacctcgggcagcaccggc
cgtcccaagggcacgctcctccagcaccggggcctgtgcaacacggccctccagacgggc
cacgccatggggctcgagacggggagccgcgtcctccagttcttctccgccggcttcgac
gcgtcggtctgggagatcttcggcgcgctgctctcgggggccaccctggtgctggcgccg
cgtgagcggctcctcccgggggcaccgctgcgcacgctggctcgcgacgagtccatcacc
gccgtcacgctgaccccgtccgtcctcgcgcagctctcgcccgaggacttcccttcgctg
cggacactggtctccgccggagaggcatgcacgccggagctggtgcatcgctgggctccg
cacgtgcgcttcctcaacgcgtacggtcccacggagacgaccgtctgcgcctccatcacc
gagccgctgtccgccggacagcccctcaccatcggccgcccgtgggcgaacctccaggtg
tacgtcgtcgatgcgacgatgcgcccgcagcccgtcggggtgccgggtgagctgtgcgtg
gggggcgtcggcctcgcgcgcggctacctgggacagccggggctcaccgccgagcgcttc
atcccggatgcgctctccggcgtgcccggagcacggctctaccgcaccggagaccgggcg
cggtggcgtgccgatggaaccctcgagtacctgggccgcatcgactcgcaggtgaagctg
cgcggcttccgcatcgagctcggtgaggtcgaggccgtcctgtctcggctccccttcgtg
cgcgaggccgtggccaccgtgcgcgaggactctcccggcctcacccgactggtcgcctac
gtcgtggcggaggaggacagcatcctcgaggtggcctcgctgcgcgcggccctcaaggag
cggctgcccgagcacatggtgccgtccgccatcgcgctcctccccacgctgcccctgacg
gcgcatgggaaggtggaccgccgcgccctgcctcctcccgagggcgccggtgaggcggac
acccgcgagtacgtcgcgccgcgcaccccgaccgaagagcggctcgccgcgctctggcgg
gagctgctgcacgtcgagcgcgtcggcgtccatgacgacttcttcgagctgggcgggcac
tcgctgctggccacgcagtccctctcccgcgtgcaggccaccttcgggattgagctgccg
ctgcgtgagctcttcgaggcgcccaccgtcgagcggctcgccgcgcggctggaggccctg
gcccagacgggtgccaacacctcgaaggtccccgcgctgacgcccgcgccgcgcacggga
gacctgccgctgtcgttcgcacagcagcggctgtggttcatcgaccagctcgagcccgga
agctcgctctacaacatccccacggccctggagctcgagggcccgctggatgtccccgca
ctggagcgcgccttcaccgagctccaccggcgtcacgagtcgctgcgcaccaccttcggc
acggtggatggacaggccgtccagcgcatccaggcgcccgcgcccttccagctccccatc
gtggcgctggagtcactcgcgccggagaagcaggcccacgcgacgggccagtggatgtcg
gaggaggctcagcgcccgttcgatctcgcgcgcggtccgctgctgcgcgccacgctgttg
cggcgggccgcgacttcgcacgtgctgctcgtcaccatgcaccacagcgtctccgacgcc
tggtccatgagtgtcctggtgcgcgagctggtggccttgtacgaggccttccgcgacggc
cgcgcctcaccgctgccggagctggccgtgcagtacgcggacttcgccgtgtggcagcgt
ggctggctgcgagacgaagccctggcggagcagctcgcgtggtggcgtgacgcgctgacc
ggtgcgcccgccctgctggagctgcccacggaccggcctcgtgccgcgctgccctcacgt
gaggcggcgctccatcccgtcatcctcggagccgagctgtccgaggccgtcaaggcgctc
tcccagcgtcacggcaccacgcccttcatgacgatgctggcggcgttccagctcctcctc
tcccgctactccggacaagaggacgtcgtcgtcggctctcccatcgctggacgcaaccgc
gcggagaccgaggacctcatcggcttcttcgtcaacacgctcgtcctgcgtgcacgcatc
gctccgagtgcgtcgttcgcggacctgctctcccaggtgaagcactccaccctgggtgcc
ttcgagcaccaggacgtgcccttcgagaagctcgtcgaggagctccagccccagcgcagc
ctcggcttctctccgctcttccaggtcaccttctccctgcagaacgcgcccacgggcagc
ctggagcttcccggactgagcctgcgtccgattgcgccctcgggcctgctcgccaagttc
gacctggacctctccctctccgagtccgcgtctggcttcgagggtgcgctccagttctcc
accgcgctcttcgatgcctccacggccgcgcgcatggcgacgcacttcctcaccctgctg
cgcgccgccgtcgcccagcccgaggtgcctgtcacctccctggcgctcatggagtccgat
gagcgccgccgcctcctcgtcgagtggaatgacaccaacgccgacttcccgcacgacagc
cctgtccatctgcaggtctccgctcgcgcggcgctcacacctcatgccctcgcagtgctt
tcggactcgggctcgctctccttcgcccagctcgaagcccgctccaacctcctcgcgttc
cggctcgtcctggcgggagtgaagcccggctcactcgtcgcgctcttcatggagcgctcg
ctcgagcttcccgtcgcgctgctcgccatcctcaaggcgggcgccgcctggctcccgctc
gacccggcgtaccctcgtgagcgcctggcgttcatgctccaggatgcctcgcctccggtg
ctgctcacccagcctcacctccaggcggcgcttcctcctgggcccaccgtcatctgcctc
gatgctcagtggggcgcgcaggcggacgcggactctcggctcaccttcaccagcgtcccc
gtcgcggcctccagcccggcgtacgtcatctacacgtctggttcctcgggtcagcccaag
ggcaccctcgtctcccatcaggccctcgccaaccacatggcgtggttcctctcctccttc
cccctctcctcccacgacagggtcctcctcaagactcctctcagcttcgatgcctccgtc
tgggaagtctgggctcctctcctctctggcgctccgctcgtcctcgctcctcccgaggcg
caccgcgacccggccgcgctgttggcctgcgtctcccgccaccgcatctccgtcctccag
ctcgtcccttccctcctccgcttcctcctcgaagaggcagggctctccaacgcctctcac
ctccgcttcctcttctgcggtggtgaggctctgccgtcctctctcgcccgccgcctccac
gcggcgctcccctccacccggctcgtcaacctctacggccccaccgaagtcaccatcgac
tccacgttctccttcgcctcaccggcggagtctcgcgtggccatccccatcggtcggccg
gtctccaacactcgggcctacgtcctcgactctcagctccagcccgtccccacgggcgtt
ccgggcgagctgttcctcgccggcccccagctcgcgctcggctacctccaccgtcctcac
ctcaccgccgagcgcttcgtcccgaaccccttcagcaccgagcccggtgctcgcctctat
cgctccggcgacaaggtccgctggctctcggacggctccctcgagtacctgggccgcttc
gacttccaggtgaagctgcgcggccagcgcgtcgagctcggtgacgtcgaagccgcgctc
ctcgctcacgccgatgtccgcgaagccgtcgcgctcgtgcgtgaagactcgccgggccac
cagaacctcgtgggctacgtcgtggccccggagacggcggatgtcgtcgccgtccgtgcc
tccctcctcggacgtctgcccgagtacatggtgcccgccgtcctcgtgcggctggacgcc
cttccgctcaccgccaacggcaagctggaccgcaaggccctccccgcacccgacgcgtcg
ctcaccgacgcctacgtcgcgcctcgcagtgccaccgaacagacggtggcccacctgatg
gcggagctgctgcacatcgagcgtgtcggagccgaagattccttcttcgcgctcggcggc
cactcgctgctcgccacccagctcgcctcgcgcatccgcgcgacgttccaggtcgagctg
cccctccgcgcgctcttcgagttgcccactgtctcggccttcgccgcgcgcatcgacacc
agcgcccgcgaggagtcttccgcgcggcccccgctcgttccgctgcctcgctccgagacc
tccccgctgtcgttcgcacagcagcgcctgtggttcatcgaccagctcgagccgggaagc
gctctctacaacatccccaccgccctccacctcgaaggagccctggacgtcgccgcactg
gagcacgccatctccgatgtcgtcgcccggcatgaggcgctgcgcaccaccttcgagtct
tcatccgaaggacagccgctccagcgcgtccacgcggccgcgccggtcaccattccgcgc
gtcgacctccgtcctctcgacccgacctcgcgttcgttcgaggagcagcgcctcgtcctc
gaggaggccactcgcccgttcgacctgacctccggccccctcttccgcctctgcctcctc
cagttggaggaggacacccacctgctgctcttcaccatccaccacatcatctcggatggc
tggtccaccggggtcgtggtgcgcgagctgggggcgctctacgcagcgcacctgtccggc
actccggcggccctgcccgcgctgcccgtgcagtacgcggactacgcagcctggcagcgc
ggctggctgcgcgatgacgcgcttcgctcggagctcgactactggaagcagcacatccag
ggcgccccggcactcctggagctgcccaccgacaggccgcgccccgccatccaatcgcgt
gaggcggcgcttcatcccgtcgtcctcggagccgagctgtccgaggccgtcaaggcgctc
tcccagcgtcacggcaccacgcccttcatgacgatgctggcggcgttccagctcctcctc
tcccgctactccggacaagaggacgtcgtcgtcggctctcccatcgccggacgcaatcgc
gcggagaccgagggcctcatcggcttcttcgtcaacacgctcgtcctgcgtgcgcgcatc
gctccgagtgcgtcgttcgcggacctgctctcccaggtgaagcactccaccctgggtgcc
ttcgagcaccaggacgtgcccttcgagaagctcgtcgaggagctccagccccagcgcagc
ctcggcttctctccgctcttccaggtcgccttctcgctcctcaacgccccctctggagat
ctcgtcctcccggggctcgagctccgtccgcttcctccgtctggactcctcgccaagttc
gacctggacctcgccctctccgagtccgcctctggcttcgagggtgcgctccagttctcc
accgcgctcttcgatgcctccacggccgcgcgcatggcgacgcacttcctcaccctgctg
cgcgccgctgtcacccagcccgaggtgcccgtctcctcactcccgctcatggagtccgat
gagcgccgccgcctcctcgtcgagtggaatgacaccaacgccgacttcccgcacgacagc
cctgtccatctgcaggtctccgctcgcgcgacgctcacgcctcatgcactcgcagtgctt
tcggactcgggctcgctctccttcgcccagctcgaagcccgctccaacctcctcgcctct
caccttgtccaggcaggggtgaagcccggctcactcgtcgcgctcttcatggagcgctcg
ctcgagctgcccgtcgcactcccctccgccatcctcaaggcgggcgccgcctggctcccg
ctcgacccggcgtaccctcgtgagcgcctggcgttcatgctccaggacgcctcgcctccg
gtgctcctcacccagcctcacctccaggcggcgcttcctcctgggcccaccgtcatctgc
ctcgatgctcagtggggcgctcaggcggacgcggactctcggctcaccttcaccagcgtc
cccgtcgcggcctccagcccggcgtacgtcatctacacgtctggttcctcgggtcagccc
aagggcaccctcgtctcccaccaggccctcgccaaccacatggcgtggttcctctcctcc
ttccccctctcctcccacgacagggtcctcctcaagactcctctcagcttcgatgcctcc
gtctgggaagtctgggctcctctcctctctggcgctccgctcgtcctcgctcctcccgag
gcgcaccgcgacccggccgcgctgttggcctgcgtctcccgccaccgcatctccgtcctc
cagctcgtcccttccctcctccgcttcctcctcgaagaggcagggctctccaacgcctct
cacctccgcttcctcttctgcggtggtgaggctctgccgtcctctctcgcccgccgcctc
cacgcggcgctcccctccacccggctcgtcaacctctacggccccaccgaagtcaccatc
gactccacgttctccttcgcctcaccggcggagtctcgcgtggccatccccatcggtcgg
ccggtctccaacactcgggcctacgtcctcgactctcagctccagcccgtccccacgggc
gttccgggcgagctgttcctcgccggcccccagctcgcgctcggctacctccaccgtcct
cacctcaccgccgagcgcttcgtcccgaaccccttcagcaccgagcccggtgctcgcctc
tatcgctccggcgacaaggtccgctggctctcggacggctccctcgagtacctgggccgc
ttcgacttccaggtgaagctgcgcggccagcgcgtcgagctcggtgacgtcgaagccgcg
ctcctcgctcacgccgatgtccgcgaagccgtcgcgctcgtgcgtgaagactcgccgggc
agtcagcgcctcgtcggatacttcgtcgcgtcgcaggccatggacgtcccggccctgcgc
gagttcctcctcgcgcgcctccccgagcacatggtgccctcggcgctcgtcccgctgacg
gccctcccgctcaccgccaacggcaagctggaccgcggcgcgctccctgctcccgactcc
acgacctccgactccttcgtcgcgcctcgcaacgagctggagcaggcgctcgccacggta
tgggcccaggtgctgcgcgttccgcgcgtcggcatccacgacaacttcttccaactcggc
ggcgactccatcatcagcctccagctggtcgcgcgggcccgccgctcgggcctgcacttc
acgcctcggcagctcttccagtcgcagaccatcgccacgctggcgcctgtcgtctcccgg
ctccaggccatcaccgccgagcagcagcccgtcgtcggccccgtcctcctcacgcccatc
cagcgcgcgttcctcgagaacccgaaccccgcgccgcaccactacaaccaggcgctgatg
ctgcgactgcgcgagccggtgggcacggaggccctcgactccgccctgcgcaagctggtg
gagcaccatgacgccctgcgcctgcgcttcgtccaggaggacggccgctggagccagcac
aacacccccgtcgagcacgcgccctcactgtggcgcgaggacgtgtcggcgctctccgag
tccgagcgcatcgcgaggatggaggccgtcgccacccaggcccagtccaccttcgacctg
ggcacggcgccgctcttccgcgcggtccacttcgacttcggtccccaggagtccgcgcgg
ctgttgctcgtggcccaccacctcgtcgtcgatgccgtctcctggcgcatcctcgtcgag
gacctggagaccctctgccggcaggcacggaagggcgagcccctctcgctcccggccaag
accacgtccttcaagacctggtccgagcgcctgcaccagcatgcccgctccacggcgctc
gacgccgagcgcgcctggtggctggacgaagcccgagcccgcgtcctcccgctcccgcgt
gacagggcggacggagcgaacaccgccgcctccgctcacaccgtctccctgagcctcgac
gtcggagacacgggcctgctgctgcgcgaggtccccgcggcgtaccgcgcccgcctccag
gacgtgctgctgggcgcactgggccgagccctcgccctccgcacgggtcagtcgcgcttc
ctggtcgaagccgaaggccacggccgcgaggacctcttcgccgacgtggacctgtcgcgc
accgtgggctggttcacctcgctctaccccgtgctgctccaggtgggcaccggtgacagt
ccaggcgacaccgtgcgctccacccgcgacgcgctgcgcgccctgcccgccaacggcctg
ggacacggcctgctgcgccacctgcgcgacgacgacacgcaggcccggctcagcgcgctg
cccgtgcccgaggtgtccttcaactacctgggccaggtggacgtcaccgccagcgacacc
tcgctcttcaccttcgcctcggaggcccagggcccgtccatgagcccacgtgccccgcgc
gcgtacgtgctcgacgtgtcggccgtcgtgcagggtggacagctccacgtctccatcacc
tacagccgcaacctccacgatgaaggcacggtgcgcgccctcctcgagtccttcggggag
gccctgcgcctgctcgttgcgaatcgagcgaccgccgatgcgctgcgctacaccccggcc
gacttcccgctggcgaacctgacccgggaagcgctggaccacgtgctcccctcgggcgtg
cccgtggaggacgtgtacccgctgtccgccttgcagcaaggcatgctgctgcactcgctg
atggcgccgggctccggcgtgtacgtcacgcagttcggttggacgttcggcgcgcggctc
gacctgggactcttccgccgcgcgtgggagacggtggtggagcgccacgcccccctgcgc
accacgttcgtctgggacggcctggccgagcccgtccaggtggtgagcccgcgcaccgtg
ctgccgtgggaggagctcgactggcgtggtctgccgcccgccgagcagcagtcccgcttc
agcgccctcatggcctccgaccgggtccggggcttcgacctgcggcaggcgccgctgatg
cgcctgaccgtcgtgaagctggacgaaggggcgcaccgcgtcctctggtcctcgcatcac
ttgctgatggatggctggagcctcggcctcgtgttcaaggagctgttcgcgctctacgac
gcggcggcgaaggggcagcgtgccacgctgggcaccgcgcccgcgtatcgcgacttcatc
tcctggctgcgcgaggacaccaccgcgagcgctgaggcctattggcgcgaagccctccag
ggcttcaccacgccgacgccgctgcccggctcgcgcctccccgacacggagaacgcgccg
tacaagcagggcgagcgcggcctcctgttgagcgcggagacgacacaggccctgcacgcg
tacgcacgccagcatcagctcacggccaacaccgtgctgcagggcgcctgggcgctcgtg
ctcgcccggtactccggtgagcgcgacatcgtcttcggcaccaccgtgtcgggtcgctcc
accgaggtggccggcatcgagcagatggtcggtctgttcatcaacacgctgcccctgcgc
agccggttggacccggacctgtcggtcgtcgagtggctcggctcgcaccatgcgcagatg
caggcgctgcacgagcgcgagcacgactcgctggcgcgcatccagggttggagcgaggtg
cctcgcggccagtccctgttccagagcctctacgtcttcgagaactaccccgtcgacgac
gccgtctactccggcggcagcgacttccaggtccgggacctcgccagcgccgagcagtcg
gacatgcccttcgtggccatcgtcatgccgggcccccggatggagctgcgcctcgtctac
gacagccagcgctaccagacggcggtgttggagcaggtgctgcaccactggaacacggcc
ctggaggccatgctggcccatccacgggccctggtgtcctcgctgtccctgctgacggcg
gaggagcgcgagcgcgtcctggtggagtggaaccagacggacgtcgcctatccacgcgac
acgagcgtgcacgagctcttcgccacgcaggccgcgcggactccggacgccatcgccgtc
gcgtccgacgtgggcacgctcacctatcgggagctggatgcacgcgccaatcagctcgcg
cggcacctgcgcaccctgggcgtcacacccggcacgcgcgtggcgctgtgcctggagcgg
agcctggagctgcccgtggggctgctgggcatcctcaaggccggcgcggccttcgtgccg
ctcgaccccgcctacccggcggagcgactggaggccatgctcgcggggacggcggcctcc
gtcctcgtgacgcaggagcggctcgccgatgagctgcccgcctacgtcccgctcgtcgtg
tgcctcgactccgagtgggacctggtcgcgcgtcagcccccgtcggcgctggctccgtgc
gcggacgcggacagcctcgcgtacgtcatgttcacctcgggctccaccggacagcccaag
ggtgtcgccattccccaccgcggcatcacccgtctggtgatgagcggcgacttcatccac
ttcggccccgaggaggtcttcctccagctcgcgcccagctcgttcgacgcgtccacgctg
gagctctggggtgcgctgctgcacggcgctcgcctcgtcctcttcccgcctcacacgccc
acgctggaggagctgggcgcgacgctggtgcgccaccgcgtcaccaccctgtggctgacc
gcggccctgttcgagcagatggccatccatcagcccgcggccctggcctccgtgcgccag
gtgctggcgggaggcgacgtgctgcccgtgcggcgcgtgcgcgagcacctctcgcgcgtg
gcccccggctcggtgctggtcaacggctacggccccacggagaacaccaccttcacggcg
tgccaccgcatggaggcgggctccgtcatcggcgccaccgtgcccattggccgccccatc
tccaacacgcgcgtcttcgtgctcgatgagcgcatggagcccgtgctccccggtgcgccg
ggcgagctgttcaccggtggagacggcctcgcctggggttacctgggccggccggacctc
acggccgagcgcttcgtcccccaccccttcgccccgggagagcggctctaccgcacgggc
gacaaggtgcgctggaaggacgacggcacgttggagttcctcggccgcacggacttccag
gtcaaggtgcgtggcttccgcatcgagcccggcgaggtggagaacgtcctccgcctgcac
ccgagcgtgagcgaggccatcgtcgtggtgcgcgaggactcgcccggcgacaagcgcctg
gtggcctatgtcgtggcgcccgacgccgacgtcgcggggatgaaggagttcctgcgccag
aagctgcccgagtacatggtgccctcggccctcgtgtgcctggagtccctgcccctcacg
cccaacggcaaggtggaccgccgggccctgcccgcgccggagctggagggcgcgagcgcc
gacaccttcgaggcgcccctcggcgccaccgaggtcgcgctggccagcatcttctccgac
gtgctgggcgtcccgcgcgtggggaggaaggacgacttcttcgagctgggcggacactcg
ctgctcgccacgcaggtcgtctcgcgcatccgcgcgacgttcgacctggagctggcgctg
cgtgagctcttcgagtcaccgacgctctccaccctggccggacaggtggatgccctgcgc
ctggagcgccagggcctgggcctgccgccgctcgtgcccgtgccgcgcacggaggcgatg
ccgctctcgttcgcgcagcagcggctgtggttcatcgaccagctcgagccggccagcccc
ctctacaacatgccctccgcgctgcgactggtgggcgagctggacgtggccgcgctggag
cgcgccatctccgacgtggtggagcggcacgaagccctgcgcaccaccttcgcctcgcgc
gacggtgagcccgtgcagcacatccacccggccgtccccgtgacgctgcccgtggtggac
ctgggcctcctgcccgccgccgagcgcaccgccgaggtgcaccgcctcgcgaacgcggag
tccctgcgtcccttcgacctggccacgggcccgctcttccgcgtcacgctgctgcgcgtg
gacgaagcggagcacgtgctgctgtcgacgatgcaccacatcgtcttcgacggctggtcc
accggcgtgctggtgcgcgagctgggtgcgtactacgcggcgcacctgtccggaacacag
gcggagctgccgccgctggccgtgcagtacgccgacttcgcggcctggcagcgaggctgg
ctgcgcgacgaggcgctcgcgacgcgcctgggctactggaagcgccggctcgaaggcgcg
ccggcgctgctggagctgcccaccgacagaccgcgtccgtccatccagacgcgcggcgcc
gcgcaacaggccgtcgtgctgcccgcggacctctcccacgccgtcaagacgctgtcgcag
gcgcatggggccacgcccttcatgacgctgctggccgcgttccaggtgctgctcgcgcgg
tactccggacaggacgacgtcgtcgtcggctcgcccatcgccggacgcaaccgaggagag
accgagggcctcatcggcttcttcgtcaacacgctggccctgcgcacgcggctggactcg
cgcgacaccttcgcgtcgctgctgacgcaggtgaagcgcaccacgctggaggccttcgac
caccaggacgtgcccttcgagaagctcgtcgaggagctccagcccgagcgcagcctcagc
tactcgccgctgttccaggtgatgttctccgtgctgaacacgcccatgggcgcattggag
ctgccagggctgcggctggagggactcggcgacagggagctgcccctcaagttcgacctg
gacctctcgctgacggagacgcccgagggcttcgcgggcacgctcgactacaacgtcgac
ctgttcgacggcgccaccatgggccggatggtggagcacctgctcaccctgctccgcgcg
gccgtcgccaaccccgagcagccgctctccgccctcccgctgatggacgaggccgagcgt
cagcgcctcctcgtcgagtggaacgacacggcggtgcccgtccccagcgacgccagcgtc
caccaccagctctccgcccaggccacgcgcacgccggaggcactcgccgtcgtctccgac
gagggctcgctcacctacgcgcagctcgacgcgcgctcgagccggctcgcggcgcacctg
cgctcatcgggtgtgaagcccggcgcgctggtggcgctgtgcatggagcgctcgctggag
gtgcccgtcgccgtcctcggtgtgctcaaggccggtggcgcctacgtcccgctggacccg
gcctatccgcgtgagcggctggccttcatgctccaggacaccgccgccccggtgctgctc
acgcagcggcacctcctgggcgtgctgcccccggggcccgcggtggtgtgcctcgacgcc
ggctgggaggccgagctcggtgccacgacggcgctcaccgacagcgtgccttcggagagc
gcggcctacgtcatctacacgtcgggcagcaccggtcagcccaagggcaccgtgttgacc
catcgctccctctccaaccacgccgcgtggatgcgctcgacgttcgggctgggagcggga
gagcgtccgctgctcgtcacgtcgctcagcttcgacgtgtccgtcgccgagctgttcgcc
acgctcctgtccggagccaccctggtcgtcgccccgcgcgaggcccaccgcgacccggcc
atcctggcggagacgctggtgcggcacgacatcacgctgctccaggtggtgccgtcgctg
ttgcgagtcctgctggaggagccgcgtctgcgcgcggcctcgaacctgcgccggctcatc
tccggcggcgaggcgctcccggccgaccttccgccgcgcgtgcgagaggtgctgcctcac
gcgcgcctggacaacaactacggtccgacagaggccaccatcgacgccaccacgtggccg
gtggagcccttctccggccccgtggcgcccatcggccggcccatggccaacacccaggcc
tacgtcctggacgcggccctgcggcccgttcccacgggagtgcccggcgagctgtacctg
ggcggcgagggcctggcgcgtggctacctgaaccggcccggcatcaccgccgagcggttc
ctccccgaccccttcgcctccgagcctggcgcgcggctctaccgcacgggcgacaaggtg
cggtggcgggcagatggcacgctcgactacctgggccgcatcgacttccaggtgaagctg
cgcggtctgcgcatcgagctgggtgaaatcgaggccgcgctcctgcggcagccagacctc
cacgaggccgccgtcctggtccgcgacgagctgctggtcgcctacgtggtgacgcgcccg
gggctcacggtcgacgccgcccagctgcgacaagggctgctcacggggctgcccgagtac
atggtccccgcggccttcgtggcgctgcccgccctcccgctcacgcccaacggcaagctg
gaccgcaaggccctgcccgcgccggacgtccacgcgagtggtgcgtccgaatgggtcgcg
cctcgcacgcccacggagcagacgctggcggagctgatggccacgctcctgcgcgtcgag
cgcgtcggggcggtggacaacttcttcacgctcggcggccactcgctgctcgccacccag
ctcgcgtctcgcatccgcgccgcgttccaggtggacctgcccctgcgcgccctcttcgag
gagcccacggtcgcgggcctcgccgcgcgcatcgacgccagccggcgggaggtctcctcg
gttccggcgctcgtgcccgtgtctcgcgagcaggccctgccgctgtccttctcgcagcgg
cgcctgtggttcatcgaccagctctctcccggcacgccgctgttcaacctgcccaccgcg
ctgcgcgtggagggggacctggacctcgccgcgctggagcaatccttccgcgcgctggtg
agccgccacgaggtgctgcgcaccaccttcgccgtgcaggacggcgagcccgtgcagcgc
atcctccccgccccggccttcaccgtgccggtggtggacctgagcgcgctgtccgaagag
gcgcagcaggcgcggacccgcacgctcgtcgcggaggacgccctggcgccgttcgacctc
gccacggggccgctcctgcgcgcctcgctgctgaggcatggcgcgaggaaccacgtgctc
ctggtgacgatgcaccacatcgtctccgacgcgtggtccacgggcctgctcgtgcgcgag
ctggccgcgcagtacctggcccacacgacgggcacctcggcggcgatgtccccactgccc
gtgcagtacgccgactacgcggcctggcagcgctcctggctgcgcggcgacgcactccag
cagcagctcgacttctggaggcagcacctctcgggtgcccccggtgccctggagctgccc
accgaccggccgcgtccggccatccagtcccaccgaggcacgctgcttcccgtcgagctg
acggcggagctgagcgcgtcggtgcgggcgcttgcccagcgcgagggcgccacgccgttc
atggtgctgctcgcggcctggcagctcgtcctcgcccgctacgcgggacaggatgacgtc
tccgtcggcttccccatcgccaaccgccagcagaagaagacggaggagctcatcggcttc
ttcgtcaacacgctcgtcctgcgctcgcgcatcgacgcgcggggctccttcctccagctc
ctcgcccaggtgcgaagcgccacgctggccgcgtaccagaaccaggacgtccccttcgag
aagctcgtcgaggagctccagccccagcgagacctcgcgcgcagcccgctcttccaggcc
accctcaccctccagaacacccccgccgagtccacccagctcccgggcctcaccttccgc
ccgctcacgccggacctcaccacgtcgcagtacgagctcagcctcctgctggaggaaggg
ccccagggcttcgtcggcgcgctcaactacaacaccgacctcttcaacgcggacacgatg
cggcggctgatgcgccactacgccacgctgctgggcgccatcaccaccgcgccggagcgt
ccggtgggcctgctgcccctcatgtcctccgaggagcagcaccaggtcctggcacagtgg
aaccacacgcccacggagtacccgcgagaggcgaccctccctcagctcttcgcacgtcag
gccgcgctcaccccgaacgcgctcgccgtcgagtccgagacggagcgcctcacgtatgcg
cggctcgagtcgcgcgcgaaccagctcgcccaccacctgcgcgcgctgggtgtgcagccc
ggcagccgtgtcgcggtgtatctgcaccgctccgcggacctggtggtggcgctcctcggc
atcctcaaggcgggcgccgcctacgtcccgttggatggctcgtggccgaccgagcggatg
gcgtgggtcctgcgccagtcctccgccgcggtcctcctgacggagtcctccgtcgcggac
gagctgccggagctgggcgccgtgctcctcgtcctcgatgaggaggccacgcgcatcgcc
cgtcgtccggagaccgcgcccgaggtgttcacgagcgcggacgccctggcctacgtcatg
ttcacctcgggaagcacgggccagcccaagggcgtcagcgtgccgcaccgaggcatcgtc
cgactcgtgcagccccacggcgtcatccgcttcgggcccgacgagacctggctccaggcg
gccccggtcgccttcgacgcctccacgctcgagatctggggcgcgctgctgcacggcgcg
cggctggtcatcgcgccgcccggagcactctccctcgaggagctgggggcgctgctcacc
cgccaccgcgtctcctcgctgtggctcaccgcggccctctacgagcagatggtggcctac
cagccgcgggccctggccggtgtctcccaggtgctcgcgggtggcgacgtgctgccctcg
cagcgcgtgcgtgaacacctggcgctgctgcctccgggcggcgtcctcatcaacggctac
ggccccacggagaacaccacgttctccgccacccacgccttgcgcgcgggcgacgcggtg
ggcgactccgtccccatcggcaagcgggtgccgcactccaccaccttcgtgttggacggc
gccctccagccggtgcctccgggcgtgacgggcgagctctacgtgggaggcgatggcctc
gcgtggggctacctcgagcgacccgacctcacggcggagcgcttcgtgccgaaccccttc
ggggctccgggtgcgcggctctaccgcacgggcgacaaggcccggtggttggcggacggc
acgttggagttccagggccgcgccgacttccaggtcaaggtgcgtggcttccgcatcgag
ctcggtgaagtggagagcgccctgcgccagcacccgggcgccagcgaggtcatcgtcgtc
gtgcgcgaggacgcgccgggcgacaagcgactcgtcgcctacgtggtgccctcggcccag
ggtctggacgcgggcgtcctgcgcacgttcctcgaggagcggctccccgcgtacatggtg
ccgtccgccatcgtcatgctcgcggagctgccgctgacggccaacggcaaggtcgaccgc
aaggccctgccgccgccgggagccagcgccccgacgcccgagctgcccgaggctccccgc
accgccacggaagagctgctcgcgggcatctacgccgaggtgctcggggtctcgcgcttg
ggtcctcgggacgacttcttcgagctgggaggccactccctcctcgccacacaggtcgtc
tcgcgcatccgtgccaccttcaacatcgagctgccgctgcgcgagctcttcgaggctccc
accgtcgccgggctcgcccggttcgtggagtcctcccggcaggaggcgcagggactcgcg
gccccgccgctgacggcagtgcctcgcacgggcgccctgccgctgtccttcgcgcagcag
cggctgtggttcatcgaccagctcgagccgggcagcgcgctctacaacatccccacgacg
ctccggctcgaggggacgctcgacatcaccgccctggagcgcgcggtctccgacgtggtc
gcgcgccatgaggcgctccgcaccaccttcgcgtccatcgacggacagccggcccaggtc
atccacgccgccgctcccgtcaccattccgctcaccgagctccagcacctgcccgaggcc
caccgccaggccgaggcccgtcgcctggcgcaagaggaaggggagcgcgcgttcgacctc
gccacggggccgctcttccgcctgagcctcctgcggctcacggagcgcgagcacctgctc
ctcgccaacgtccaccacatcgtctccgacggctggtcgtccggcgtgctggtgcgcgag
ctgggtgcgctctacgcggcgcatctgtccggcgtgcccgccgagctcgcgccgctgacc
gtgcagtacgccgacttcgcggcctggcagcgcggctggctgcgggacgagaccctccgg
acgaagctggcctactggaagcagcagctccacggcgcgcccccgctcctggacctcccg
acggacaggccgcggaccgagcctgcgtcgcgaaaggccgccaacctccccctctcgctc
ggggccgagctgtccgacgccgtccgggtgctctcgcagcaacagggcgccacgcccttc
atgacgctgctggccgccttccagctcctgctctcgcgctactccgggcaggacgacatc
tccgtcggttcccccatcgcgggccgcaatcgcgcggagaccgagggcctcatcggcttc
ttcgtcaacaccctcgtcctgcgcacacgcatcgacccgcgcacgtccttccgcgagctg
gtggaccgcgtccgcgtcaccaccctgggcgcgtacgagcaccaggacgtcccgttcgag
aagctcgtcgaggagctgcagcccgagcgcaccctcggcgtctctccgctgttccaggtc
atgttctccctgctgaacacgcccatgggagggctggacctgccgggcctgcgagtgcac
tccgtcgactacgacgacgcgcccgcgaagttcgacctcgacctcttcttcaacgagacg
gcctccggctacgagggcgcgctccaggtctccaccgcgctcttcgatgcctcgaccgcc
gagcgcatggcggcgcacttcctcacgctgctccgcgccgcggtgacccagccggagcag
cccgtcttcaccctgccgctcatggacaccaccgagcggtaccggctcgtcgtggagtgg
aacgacgcggcgtcgagcacgcgggcctacgtcctcgacgagttcctggagcccgtcccc
gtgggcgtcccgggcgagctcttcctgggcggtgtccaccacgcgctcggctacggacag
ggcgcgcagctcaccgcggagcgcttcctgccggatgcgctcagtggtgtgtcgggtgcg
cggctgtaccgcaccggagacaaggtccgctggcgcgcgaacggcgccctggaacacctg
gggcaggtggttccccgcgccacgcggcgtggacagcgcgcggagctcgatgaggtcgag
gccgcgctgcgcgcacatccacacgtcgaggaggccgccgccctcttccgggaggacagc
cccgggaagaagcgcctcgtcgcgtacttcgtgccgagaggcgcgctcgaccagaccgcg
ctgcggaccttcctccgggagcggctctccgagtacctggtccccaccgccttcgtgtcc
ctgccggcactgcctcgcacggcgagcggaggcgtggaccgcgacgcgcttcctccccac
ggagcgacggccgacgtgcagcccgcgtggaacccgccgtcaacgccgaccgagaaggtg
ctcgccgggctcatgtccgacctcctgcgcgtcgagcgcgtgggtgcgaccgactcgttc
ttctcgctcggtggccactcactcctcgccacgcagctcgtctcccgcattcgcgtgacg
ctcgaggtggagctgcccctgcgggcgctcttcgagaaccccacgccggagtctctcgcc
gcgcgcatcgacgctgtcactcgggccgcgccactgaccgcgcctccgttggtgcccgtg
tcgcgcacgggagcgctcccgctctccttcgcgcagcagcgcctgtggttcatcgaccag
ctcgagcccggcagcgcgctctacaacatgcccgcggcccttcgcctggaaggcacgttg
gacctggccgccttgcaggccagcttcgaggcactggttcgtcgtcacgaagccctgcgc
acctcgttcgcctcccaggacggcgaacccgtgcaggtcatccacgcgtcgtccgcgttc
ccgctgcccctcgtggacctgagcaccgtggcgacggacgaacacgcggcccaggcgcag
cggctcatcaacgaggaagcggtgcggccgttcgacctcgccaccggcccgctcctccgt
gcgtcgctgattcgcacgggcgagcaggagcatgtcctcctcgtgacgatgcaccacatc
gtctccgacggctggtcgatggaggtcctggtgcgcgagctcgtctcgcactaccaggcc
atcatcaccgggacttcgccggtcctcgcgccgctgcccgtgcagtacgcggacttctcc
gcgtggcagcgcgcctggctccagggtgacgtgctccagcggcagctcgacttctggaag
cagcagctctcgggtgctcccgccttgttggagctgcccaccgacaagcctcgtccctcc
gtccagtcctccaagggtggcgtgttgccggtccggctccccgaggacctgacgcaatcc
ctggagtccctcagccagggcgaaggggccacgctcttcatgagcctcctggccgccttc
cagctcctgctctcccgctactccggacaggatgacatctccgtcggctcccccatcgcg
ggacgcaaccgcacggagaccgagggcctcatcggcttcttcgtcaacacgctcgtcctg
cgttcgcacatcgacccgcgtgactccttccggaagctcctggcccaggtgcgcaccacc
acgctcggggcttacgagcatcaggacgtccccttcgagaagctcgtcgaggagctccag
cctcagcgcagcctgagccactcgccgctcttccaggtgatgctcgccctccagaacacg
cctcggggagagctgtcgctcgactccggtcccaccgcgctgaaggtcacccccgtggat
gcggaggacgtgtcggcgaagttcgacctctcgctctcgctcatgcggacgcagcacggg
ctcgaaggcgcactcgacttccgctcggagctgttcgaggagcgcaccatcgcgcgcctg
gtggagcacttcgtcgccctgctgaaggcggtggtctccacgccggatgcggacctgggc
tcgctgtccctcctctccgactcggagcgggagcagacactcgttcgctggaacgacaca
catcgggagctgccctgggagggtgcgctgcacgagcgcttcgccacccaggccgcacgc
acgcccgatgcgctagccgtcctcgatgacacgacgtcgctgaccttcgaccagctcaac
tgccgcgccaacaagctcgcgcatgcactgcgcgctcagggcattggtcctgagtcccgc
gtcgccctctgcatggagcgcggcgtggacatgctcgtcgcgctccttggtgtcctcaag
gcgggtggtgcctacgtcccgctggacccggctcaccctcgcgagcggcttgccttcgtc
ctcgaggactccggcgccacgctggtcctcacccagcaactcctggccgagcggctcgac
gtcccaggcgtgaagcgcctctgtctggacgacgcggccgtcacacgtgagtgggaggac
gaggccgacaccaacccgacgcaggtcacctcacccgaacacctcgcctacgtcatctac
acctcgggctccaccggcatgcccaagggcgtcatgattcagcacgcctccgtgatgaat
ctgcgcgcggctctcgcctccaccgctctcgccgggctggaaggccccctgcgcgtcagc
ctcaacgcgcccctcgccttcgacgcctccgtccagcagctcgtccagctctccgacgga
cacaccctgtgcatcgttccccaggccgttcgccaggacgcggcgctcctcgtcgcatgg
gcggacaagcaccagctcgacgtcctcgactgcgctccttctcacctgcgtctgctgctg
cgtgaaggactcgcctccactcgcgctctccgcgtcctcgtcggtggtgaggccgtggac
gaagcactctgggctcagctcgcctcgcacccgaacatcaccgccttcaacgtctacggc
cccaccgagtgcaccgtcgactccaccactcgggccatccgtggcgcggtgaagccttct
ctcggcgcacccctggccaacgttcgggcctacgtcctcgacgctcagctccagcccgtt
cccgtcggtgtcccgggtgagctgttcctctccggcgatggcctcgcgcgtggctacctc
tctcgcccggccctcaccgccgagcgcttcctccccgacccgttcagcaccatccccggc
gctcgcatgtaccgcaccggcgacaaggtgtgctggctccccgatggagcgctctccttc
ctcggccgcctcgacttccaggtgaagctgcgtggcttccgaatcgagctcggtgaaatc
gaggccaccctcgcccgtcaccctgccgtccgcgaggccctcgtcctcgtccgtgaggac
agccctggggaccagcgcctcgtcgcctactacacgtcgctgacctcgccgcctcccgag
ccctcggccctgcgcgcattcctcgccgagcggctccccgcctacgaggttcccaacgcc
ttcgttgccttggccgagttcccgctgacgcccaatggcaaggtcgacagaggagcactg
cgtccccccgaggctgctacggcgactgaagcctccatcgcacctcggacctccaccgag
gttcgcctcgcgtccctctgggcagacgtcctccgactctcgtccgtcagccggaacgac
cacttcttcgagcgcggaggccactccctcctcgccacccagttgatggctcgcatccgc
tccaccttctccgtggagctcccggttcgcgccctcttcgagtcgcccaccctcgagcag
ctcgcactccgcgtcgagcgtgccgaagcctcctcactcccgccgctgttggccgcagcg
caccatggcgctcggccgctgtccttcgcgcaacagcggttgtggttcatcgaccagctc
gagcccggcagcgcgctctacaacatgcccgcggcccttcgcctggaaggcgcgctgcac
gtatccgcgctgcaggccagcttcgaggcactggttcgtcgacacgaagccctgcgcacc
tcgttcgcctcgcacgacggcgagcccgtgcagatcgttcatccggcttccgcgttcccg
ctcccactcgtggacctgagtgccctgaggacggaggagcgcgcggcccaggcgcacaga
ctcctcaacgaagaggccatccgagccttcaacctggccaccggcccgctcctgcgagcg
accctgctccggctgggcgaacaggagcacgtgctgctcgtgacgatgcaccacatcgtc
tccgacggctggtcgatggacatcctggtccgcgagctcgtcacgaactaccaggcactc
gccacgggcgcttcgcccgcccacgcgcccctgccgatgcagtacgcggacttctccgcg
tggcagcgcacctggctccagggtgacgtgctccagcggcagctcgacttctggaagcat
cagctctcgggtgctcccgccttgttggagctgcccaccgacaagcctcgtccctccgtc
cagtcctccaagggcggcgcactgccgctccagctgcccgaggacgtgacgcagacgctg
gagtccctcagccaaggcgagggggccacgctcttcatgagcctcctggccaccttccag
ctcctgctctcgcgctactccggacaggacgaaatctccgtcggttctcccatcgcggga
cgcaaccgcacggagaccgagggcctcatcggcttcttcgtcaacaccctcgtccttcgc
tcgcgcatcaacgcgcgagcctccttccgggaactcctcgcgcaggtgcgagacaccacg
ctcggggcctatgagcaccaggatgtccccttcgagaagctcgtcgaggaactccagcct
cggcgcagcctgagccactcaccgctgttccaggtgatgctcaccctccagaacacgcct
ctgcaggagcaggcccttcactccggtcccaccgcgctgaaggtcacccccgtgagcgct
gaaggtgtctccgcgaagttcgacctctcgctctcgctcaccaggacggctcacggactc
agcggggccatcaccttccgttcggagctgttcgaggagcgcaccatcgcgcgcatggcg
aagcacttcgccaccctcctgcgcgccgtcgtctcggcgccagatgcccacgtgggctcg
ctgtccctcctctccgactcggagcgggagcagctcctcgtgcgctggaacgacacgcac
cgggaactgccctgggagggcgcgctgcacgagcgcttcgaagcgcaagtcgcccggacg
ccggatgcgctggccgccctcgatgactcctcgtcgttgaccttcgaccagctcaaccgc
cgcgcgaacaagctcgcgcatgcactgcgtgctcagcgcatcggtcctgagtctcgcgtc
gccctctgcatggagcgcggcgtggacatgctcgtcgccctcctcggtgtcctcaaggcc
ggtggcgcctacgtcccgctggacccggcccatccccgcgagcgactcgccttcgtcctc
gaggactccggtgcggcgcttgtcctcacgcagcagcgcctcgctgagcggctcgcaacc
tccgtcgtgaaggtcctctgcctggacgacccgcgcgtcaccgagtccctcgaccgtgag
gcggacaccgcactgcctcgcgtctccctgcctcaccacctcgcctacgtcatctacacc
tcgggctccaccggcatgcccaagggcgtcatgattcagcacgcctccgtgatgaatctg
cgcgcggctctcgcctccaccgctctcgccggtctggaaggtccgctgcgcgtcagcctc
aacgcgcccctcgccttcgactcctccgtcaagcagctcgtccagctcgccgatggccac
accctgtgcgtggtgccgcaggatgttcgccaggacaccacgctcctcgcggcctgggtc
gagaagcaccagctcgacgtcctcgactgcgctccttcccacctgcgcctgctgctgcgt
gagggactcgcctccactcgcgctctccgcgtcctcgtcggtggtgaggccgtggacgaa
gcactctgggctcagctcgcctcgcacccgcgcgtcacggccttcaacgtctacggcccc
accgagtgcaccgtcgactccaccgctcgggccatccgtggcgcggtgaagccttctctc
ggcgcccccctggccaacgttcgggcctacgtcctggacgctcagctccagcctgttccc
gtcggcgtcccgggtgagctcttcatctcgggagacggcgtggcgcgtggctacctcgct
cgccctggcctcaccgccgagcgcttcctccccgacccgttcagccccatccccggcgcg
cgcatgtaccgcaccggcgacaaggtgtgctggctccccgatggagagctctccttcctc
ggtcgcatcgacttccaggtgaagctgcgtggcttccgcatcgagctcggtgaaatcgag
gccaccctcgcccgtcacccctccgtccgcgaggccctcgctctcgtccgcgaagacagc
tccagcgactcgcgtctcgtcgcctacttcacgtcacgcaccaccccgcctcccgagcac
gccacgctgcgcgccttcctcgccgagcggctccctgcctacgaggtccccaacgccttc
gttgcgctcgagtccttcccgctgacacccaacggcaaggtcgacagaggagcgctgccg
cctcccgaaggaacgcctgacgccgatacgttcatcgcgccccagacctccaccgaggcc
cgcctcgcgtccctctgggcggacatcctccggctctcgtccgtcagccggaacgaccac
ttcttcgagcgcggaggccactccctcctcgccacccagctgatggctcgcatccgctcc
accttctccgtggagctcccggttcgcgccctcttcgagtcgcccaccctcgagcagctc
gcactccgcatcgagcgcgccgactccgccgcgctcccgccgctgcactccgtgtcgcgc
acgggcgcactcccgctctccttcgcacagcagcggctgtggttcatcgaccagctcgag
cccggcagcccgctctacaacatgcccgcggcccttcgcctggaaggcacgttggaccag
gccgccttgcaggccagcttcgacgccctcgtgcagcggcatgaggcgctgcgcacctcg
ttcgcctcccaggacggcgaacccgtgcaggtcatccacgcgtcgtccgcgttcccgctg
cccctcgtggacctgagtgccctggggacggaggagcgcacggcccaggcgcagcggctc
atcaacgaggaagcagtccggccgttcgacctcgccaccggcccgctcctccgtgcgtcg
ctgattcgcacgggcgagcaggagcacgtcctcctcgtgacgatgcaccacatcgtctcc
gacggctggtcgatggacgtcctcgtccgcgagctcgtctctcactaccaggccatcatc
accgggacttcgccggtcctcgcgccgctgcccgtgcagtacgcggacttctccgcgtgg
cagcgcgcctggctccagggtgacgtgctccagcggcagctcgactactggaagcagcag
ctcgtgggcgcgcccgcggtgctggagctgcccaccgacaagcctcgtccctccgtccag
tcctcccagggtggctcgctgccgttccatctgcccgaggaactgactcgagcactcgag
tccttcggccagggtgagggggtcacgctcttcatgagcctcctggcctctttccagctc
ctgctctcgcgatactccggccaggacgacgtctccgtcggttctcccatcgcgggacga
agggcctccgagctggagggcctcatcggcttcttcgtcaacacgctcgtcctgcgttcg
catatcgacccgcgtgactccttccggaagctcctggcccaggtgcgcaccaccacgctc
ggggcctacgagcatcaggacgtccccttcgagaagctcgtcgaagagctccagcctcag
cgcagcctgagccactcgccgctcttccaggtgatgctcaccctccagaacacgcctcga
caggagctcgagctccagtccggaccgggagcgctgaagctcacgtccatgggggccgag
ggtgtgtcggcgaagttcgacctctcgctctcactgctcaggacacagaggggactcgaa
gggtcgctcgacttccgctcggagctgttcgaggagcgcaccatcgcgcgcatggcggag
cacttcgtcgccctcgtgaaggcggtcgtctccacgccggatgcggacctgggctcgctg
tccttcctctccgactcggagcgggagcagacactcattcgctggaacgacacacatcgg
gagctgccctgggagggcgcgctgcacgagcgcttcgccacccaagccgcgctcacgccc
gatgcgctggccgtcctcgatgacacgacgtcgctgaccttcgaccagctcaaccgccgc
gcgaacaagctcgcgcatgcactgcgcgctcagggcatcggtcctgagtcccgcgtcgcc
ctctgcatggagcggggcgtggacatgctcgtcgccctcctcggtgtcctcgaggccggt
ggcgcctacgtcccgctggacccggcccatccccgcgagcgactcgccttcgtcctcgag
gactccggtgcggcgcttgtcctcacgcagcaaagcctcgccgagcggctcgcaacctcc
gtcgtgaaggtcctctgcctggacgacccgcgcgtcaccgaggccctcgaccgtgaggcg
gacaccgcgctgcctcgcgtctccctgcctcaccacctcgcctacgtcatctacacctct
ggctccaccggtcagcccaagggcgtcatgattcagcacgcctccgtgatgaatctgcgc
gcggctctcgcctccaccgctctcgccggtctggcaggccccctgcgcgtcagcctcaac
gcgcccctcgccttcgacgcctccgtccagcagctcgtccagctctccgacggacacacc
ctgtgcatcgttccccaggccgttcgccaggacgcggccctcttcgtctcctgggttgag
aagcaccagctcgacgtcctcgactgtgctccttctcacctgcgtctgctgctgcgtgaa
ggactcgcctccactcgcgctctccgcgtcctcgtcggtggtgaggccgtggacgaagca
ctctgggctcagctcgcctcgcacccacgcgtcaccgccttcaacgtctacggccccacc
gagtgcaccgtcgactccaccactcgggccatccgtggtgcggtgaagccgtctctcggc
acacctctcgccaacgttcgggcctacgtcctcgacgctcaactccagcccgttcctgtc
ggcgtcccaggtgagctgttcctctccggcgatggcctcgcgcgtggctacctctctcgc
ccggccctcaccgccgagcgcttcctccccgacccgttcagcaccatctccggcgcgcgc
atgtatcgcaccggtgacaaggtgtgctggctccccgatggagcgctctccttcctcggc
cgcctcgacttccaggtgaagctgcgcggcttccggatcgagctcggtgaaatcgaggcc
accctcgcccgtcaccccgccgtccgcgaggccctcgtcctcgtccgtgaggacagccct
ggggaccagcgccttgtcgcctacttcacgtcacacaccaccccgccccccgagcacgcc
gcgttgcgcaccttcctcgccgagcggctccccgcctacgaggtccccaacgccttcgtc
gcgctcgaggccttcccgctgacgcccaacggaaaggtgaatcgaggcgcactgcctcct
cccgagaccgaaacggggactgaagtcttcatcgcgcccaggaccaccaccgaggcccgc
ctcgcgtccctctgggcgaacgtcctccgactctcctctgtcagccggaacgaccacttc
ttcgagcgcggaggccactccctcctcgccacccagttgatggctcgcatccgctccacc
ttctccgtggagctcccggttcgcgccctcttcgagtcgcccaccctcgagcagctcgca
ctccgcgtcgagcgcgccgaggccgcctctctcccgccgctcgtccccgtgccgcgcacg
ggtgcgctcccgctgtccttcgcgcagcagcgcctctggttcttcgagcagctccagccc
ggcacgcccacctacaacatgcccgcggcgctgcgcctcgtgggcgccctggatgtcacc
gcgctccagcgcgccttctccgagctggtccgccgccacgaagtcctgcggacctcgttc
catgaggacaacggcgagcccttccaggtcatcgcaccgcccgcgccgttcccgcttccc
gtggaggacctctccgcgctcgacgagcgagaggacctcgcgtggaagcgcgcacacgcg
gacgccactcagccgttcgacgtgagccgcggtccgctccttcgcgccaccctgctgcgc
ctggcgccccaggagcacgtcctgctcctcaacgtccaccacgccgtctccgacggctgg
tccacgagcctgctcatccgcgaggtgacagtcctctacgcgtccttccagcaaggccgc
ccgtcaccgctgcccgagctgccgctccagtacgccgactacgcccactggcagcaccag
tggctcacgggagaggtcctcgcccggcaagtggcctggtggaagaaccacctctccggc
gcacccgccgtcctcgagctgcccaccgacttcccgcgcccggccctccagtccttccaa
ggtcgcggcgtcggcttccagctccctccggccctctcccgcgaagtggccgcgttctgc
cagcaagaaggcgtcaccctcttcatggggctgctcaccgccttccaggtcctgctctcc
cgctactccggccaggacgacatctccgtcggctcgcccatcgcgggacgcagggcctcc
gagctggagagcctcatcggcttctttgtcaacacgctcgtccttcgctcccgcatcgac
accgccgcgtccttccggcagctcctctcccaggtgcgcgcctccaccctcgcggcctac
gagcaccaggacatccccttcgagaagctcgtcgaggagctccagccccagcgcagcctg
agccactcgccgctcttccaggtgatgttcgccttccagaacacgcctcccgccaccttc
gaggcgggcgaaggcacggcctccccgctgagcttcaagccgttcgccgcggaggggagc
accacgcacttcgacctgaccctgtccgtcgtcgagacgccggagggcttcgccggtgcg
ttcacctatcgaacggacctgttcaccgaggccaccatcacccggatggcgggacacttc
gtcacgctgctcgaggccgccgtccgcactcccgcgacacgcgtgggcgagctgcccctg
ctgcccaccgccgagcgcgagcaggtgctgacgcgctggaacaaccaccgcctcgcgctg
ccctcggaagggacgctccacgagcggctcgaggcacaagtgctccgcaccccggatgcc
ctggcggtcttcgatgaccacgggacggcctcgttcgacgggttcaaccgccgcgtcaac
aggctggcgcactggctgcgttcgcgaggcgtcggtcccgaggtccgagtcgcgctcttc
ctggagcgtggcgtcgacatgctcgtcgccgtcttcgcggtcctcaaggccggcggggcc
tatgtccccacggacgtcgcgtatccgcgcgagcgcctctcgtacatcctccaggattgc
gacgcgcgcctggtcctcacgcaaagccatctggcggagcggctcgaggtcccggaggcg
aaggtcgtgtgcatggatgacgcacacgtcaccgaggccctggagcgcgagtccgacgtc
aacccggcgcgagtcgcctccgccgagaacctcgcctacgtcatctacacctccggctcc
acgggccgtcccaagggcgcgatggtgcagcatggcaccctgatgaacatgcgggccgcg
ctcatgagggcggtgcgcacggacaacgagggtccgttgcggctcgccatcaacgcgccg
ttggcgttcgatgcctccttgctgatgctcgtgcagctgacggatggccatgccttgagc
gtcattccgtcggccgagcggcaggactcggccttgatgctcgcgtggctggagaagcac
gccatcgacatggtcgaatactcgccctcgcacctgcgcgtgctgctggacgaggggctg
gcggcgcatcgcccgctgcgcgtcatcgtgggcggagacgccacggacgaggcgctctgg
ggacggctctccgcccatcctcgcctcgaggtcttcaacgcctacggccccacggagtgc
acggtgctggccacctgccatccgattcgtggagccgcgaagccgagcctgggtctgccg
ctggccaacatccaagggcatgtgctcgacgcgcgcatgcagcccgctcccctgggcgtg
cccggtgagctctacctgggaggcgacggggtcggccggggctatctcgacaggcccgac
ctcaccgccgagcgcttcgtcccggacccgttctcgtcggtgcccggcgcgcggctgtac
cgcacgggcgaccaggtgcgcaggatggagaacggcgagctcgagtacctgggccggctc
gacttccaggtgaagctgcgcggcttccgcatcgagctgggtgaaatcgaggccacgctg
ggcgccatcgccggagtccatcgcgccgtcgtcctcgcgcgggaagaccgtccgggagac
aagcgactcgtgggctacctcgtcaccgacgagggccaggtgatggacatcgccgccgtg
cgcgcggcgctgctccggtccatgcccgagtacatggtgccctccgcgttcgtcttcctc
gcggcgctcccgctcgacccgcacgggaaggtggaccgcagggcgctgcccgctccggac
atggcctccagcgaggcggagtacgtcgcgccgcgcaacgccggtgaggagaccgttgcc
tcgctctggagcgagctgctcggcagggagaaggtcggcgccaccgatgacttcttcgcg
ctgggtggccactcgctgatggccgtgcgcctcatggcgatgctgcgtgagcggaccggt
gtcgcgttgccggtgtccgcgctcttccaggctcccaccgtggagcgactggcggagcgg
gtgagtcagccgtcccagcccacgtccaacctcgtgcgactggatgagggcgcgtcgaca
gagcggcctctgttcctcgtgcacggcggcggcggcacggtgctgggctacgcggagctt
gcccgtgcgctcggcacggagcggcccgtctacggcctgtccgcgccgggactcgagggg
ggcgagctgcccgcgccgtccgtcgaggcgctggcgcgcgactacctcacgcaggtccgg
accgctcagccccgagggccatacctcctgggcggctggtccttcggcgggctcgtggca
cacgagatggctcgactgctccaggcccaaggcgagacggtggagttgctcgcgctgttc
gacagccacgcgcccacccggaagcccctggccgagcccgacctgctcacgcgactcatg
ggcttcggccagatgctcggggtgtcgtgggcggacctctccctggacgtgggccgactg
gacggcctgggggtgcgggaggtgctggcccaggtgctgcccgccctgcggcactccgcg
ccggggctgagcacgctggggctggacatggccgagcggctcttcgacgtctaccagcgg
ctcgccgaggcgaaccgggtccatgtgccgaagggtgtctacacgggcaaggcggtcctc
ttccgcgccacccgcgctcctgacgaggcccccgtgcaggaggacctgggctggagcgag
tggatcaccggagcgctccaggtgcacggcgcggagggtgaccacttcacgctgctgagc
gagccccggctctcgtcgtgggtggggcagctcgcacaagcgctggaggatgcggcgtcg
tga

DBGET integrated database retrieval system