KEGG   Myxococcus stipitatus: MYSTI_02337
Entry
MYSTI_02337       CDS       T02436                                 

Definition
(GenBank) putative ada regulatory protein
  KO
K13529  AraC family transcriptional regulator, regulatory protein of adaptative response / DNA-3-methyladenine glycosylase II [EC:3.2.2.21]
Organism
msd  Myxococcus stipitatus
Pathway
msd03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:msd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    MYSTI_02337
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:msd03000]
    MYSTI_02337
   03400 DNA repair and recombination proteins [BR:msd03400]
    MYSTI_02337
Enzymes [BR:msd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.21  DNA-3-methyladenine glycosylase II
     MYSTI_02337
Transcription factors [BR:msd03000]
 Prokaryotic type
  Helix-turn-helix
   AraC family
    MYSTI_02337
DNA repair and recombination proteins [BR:msd03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     MYSTI_02337
SSDB
Motif
Pfam: AlkA_N Ada_Zn_binding HTH_18 HhH-GPD HTH_AraC
Other DBs
NCBI-ProteinID: AGC43653
UniProt: L7U6A5
LinkDB
Position
complement(2928568..2930085)
AA seq 505 aa
MDLLDSDACYRALQTRDARFDGRLFVGVTSTGIYCRPICPARTPKQENCTFHASAAAAQE
AGFRPCLRCRPETAPDLASWRGTSNTVSRALALIAEGALDSGEAGVEALGERLGVGERQL
RRLFKQHLGATPVAVAQTRRVLFAKQLIQETRMPLAEVALASGFGSVRRFNETFQALYQR
PPGALRRKHAASAESSSAVAEAGVTLRLRYRPPYDWASMLEYLAARAIDGVEQVSRTSYR
RMVSQDGGVGTVEVSHEPARNNLVVTIRFPRVASLPAVVARVRRVFDVGADIEVIGAHLA
KDPFLAPLVALRPGLRAPGGWDGFELAVRAILGQQVTVEAARKLAGRLVALCGEGLPMPE
GLPPELGRTFPSPERVASADLTALGMPSARKGTLKALADAALADPLLFHPFGTVEEGIAR
LRSIRGVGEWTAQYIALRALRETDAFPASDVALLRSAATDEGARPSPEDLLQRAEPWRPW
RAYAAQHLWASDPGPRTRLPEARHG
NT seq 1518 nt   +upstreamnt  +downstreamnt
atggacctgctcgattccgacgcctgctatcgcgcccttcagacgcgggatgcccgcttc
gacggccggctcttcgtcggagtgacgtcgaccggcatctactgccgccccatctgcccc
gcccgcacgcccaagcaggagaactgcaccttccacgcgtccgccgccgccgcgcaggag
gcgggcttccggccctgcctgcgctgccgtccggagaccgcgccggacctggcctcctgg
cgagggacctccaacaccgtgtcgcgtgcgctggccctcatcgcggaaggcgccttggac
agcggcgaggcgggcgtcgaggccctgggcgagcggctgggcgtgggcgagcgccagctg
cgccgcctcttcaagcagcacctgggcgccacccccgtggccgtcgcgcagacgcgccgc
gtgctgttcgccaagcagctcatccaggagacccggatgccgctcgcggaggtggcgctc
gcctcggggtttggcagcgtgcgccgcttcaacgagacgttccaggcgctctaccaacgc
ccgcctggcgcgctccgccgcaagcacgcggcctccgcggagtcctccagcgcggtggcg
gaggcgggcgtgacgctgcggcttcgctaccggcctccgtatgactgggcctcgatgctc
gagtacctcgccgcgcgcgccatcgacggcgtggagcaggtctctcgcacgagctaccgg
cggatggtgtcccaggacggtggcgtgggcacggtggaggtgtcgcacgagccggcgcgc
aacaacctggtggtgacgattcgcttcccgcgggtggcgtcgctgccggccgtcgtcgcg
cgtgtgcggcgggtgttcgacgtgggcgcggacatcgaggtgattggcgcccacctcgcc
aaggacccgttcctcgcgcccctcgtcgcgctgcggcccgggctgagagcgccgggcggg
tgggacggcttcgagctggcggtgcgagcgattctgggccagcaggtgacggtggaggcg
gcgcgaaagctcgccggccggctcgtggccttgtgcggcgagggcctcccgatgccggag
ggactgccaccggagctgggacggaccttcccctcccccgagcgcgtggcgagcgcggac
ctgaccgccctggggatgccctccgcgcgcaagggcacgctgaaggccctggcggacgcg
gcgctggcggacccgctcctcttccatccgttcggcaccgtcgaggaaggcatcgcccgg
ctgcgctccatccgaggcgtgggtgagtggaccgcgcagtacatcgcactgcgcgccctg
cgagagacggacgccttcccggccagcgatgtcgcgctgctgcggagcgcggcgacggat
gagggcgcgcgcccctcgcccgaggacctgttgcaacgcgcggagccctggaggccctgg
cgggcctatgccgcgcagcacctgtgggcctcggacccgggccctcgcacacgacttccg
gaggcacgtcatggctga

DBGET integrated database retrieval system