KEGG   Myxococcus stipitatus: MYSTI_04341Help
Entry
MYSTI_04341       CDS       T02436                                 

Definition
(GenBank) amino acid adenylation domain-containing protein
Organism
msd  Myxococcus stipitatus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Condensation AMP-binding PP-binding AMP-binding_C AATase
Motif
Other DBs
NCBI-ProteinID: AGC45639
UniProt: L7UGR5
LinkDB All DBs
Position
5588702..5606392
Genome map
AA seq 5896 aa AA seqDB search
MKPSSSAALDSTLLDLLEERAGANAEAPLFTFVEDSDGDEARLSRGELWRRARRVAAALR
QGVSPGERAVLLYPPGLEYVAGFFGCMASGVVAVPAYPPDPSRLERTLPRLRAIIQDAQA
AVVLTTSFIVSMAEMLFEAAPDLRDVRWVATDELPEGLEDTWQRPDVGPDSLAFLQYTSG
STGTPKGVELTHANLLHNLRLIHGAFRMHSGSAGVIWLPPYHDMGLIGGILGTVYGGFST
TLMSPLSFLRKPLRWLTALSQTRGTISGGPNFAFDLCVRKTSEVERQSLDLSHWDVAFCG
AEPIRPETLERFVEAFAPCGFRREAFYPCYGLAEGTLIVSGVDQGTVPVLRDVAVRALGL
GTAVAPEGGESAQTLVGCGHTLPDQDVVVVDPRTHAPLPADTVGEIWVKGPSVARGYWRR
AEESEQTFQARTSTGDGPFLRTGDHGFLRDGELFVTGRLKDLIIVRGRNHHPQDVELTAE
RASRTLRPGCGAAFSRERAGEERLVLVYEVDTRQQGEPIEEVARAITQHVAETHELQLDA
LVLIEPGSLPKTSSGKVQRRACRASLLDGSLRSVAAWEASTGEEEPVSVETPPDEAPRSV
EGVEAWLRTHLARRLGVSPSALDAHEPLTRHGLDSLGAMELANGIERGLGITLPMEALLS
GPTLAELAERISRHAASSTALSLPRVSREQPLPLSFAQQRLWFLEQLEPGSPLYNISAMV
RLEGTLDVAALERAFTELTRRHESLRTTFQADSTGQAWQHIHPPTALSLARVDLSRLPPG
EQETEVRRVAEEVSRSAFDLTRGPLLRGVLLRLSDSDQVLVLCVHHIVSDGWSMDVLVRE
VGVLYDAFVRGQTSPLPEPPAQYVDHACWQREQLQGDALTRQLDWWKQQLAGAPAHLELP
GDRPRRPVRSILGASQPLHLSAESWTRLRAMAQREDVTPFMVLLAAFQALLHRYSGQEDL
CVGAPIAGRTRGVTEGLIGFFVNTLVLRSRFTSDTSFRALLGQVRDTTLGAYAHQDVPFE
KLVDELSPVRELGQTPLFQAMLVLQPDPLAKLTLPGLSLRRLPLHTQTSKFDLSLAVSEF
EGGLTGSLDFATDLFEPATAARLVEHLLTLLEAAVDAPETRVGALPLFGDAERARLLEHF
ATEATSFPARDSVLALIEEQAARHPERPAVACEEQRLTYAQLDARANQLAWHLRASGIGG
EDRVAVCLERSVDTVVALLGIWKAGAAYVPLDPEWPPSRRESLVRAVSVQAVVTTSPHAA
GMASASVPLVELDTLAEHLSDLSTSRPGASLLPQHVAYVLFTSGSTGQPKGVAVAHAQLL
NYVQAATQRLDLEACESFALVSTFVADLGNTVLFPALCLGGLLHVLTRERAANPEGVAEY
VQRHPIDCMKVVPSHLAALMTAPQPSRVLPRKRLVLGGEAPSWSLVEEVHRLAPRCEVHN
HYGPTETTVGVLAGRVSFTQPTSAAVPLGRPLANTRAYVLDAGLRLVPIGVPGELYVGGD
QVTRGYAAQPGLTAERYMPDPYSPKPGARMYRTGDRVRWLADGRLEFLGRVDFQVKLRGF
RVEPGEVEKVLERHEAVRQAVVVVREPTPGHPRLVGYVVPRAPSGVDTRALRAFLQSQVP
EYMVPSALVVLEALPLNANGKLDRQALPAPEASDTPTSSFIAPRDEVEQRLAGIWAQVLG
LARVGVHDNFFELGGDSIISLQVVARARQAGISLATRDLFQHQTLEALARVARAVPQAAA
AAEQGPVTGPAVLTPIQRHLLRHGSEHAHHYNQAVLLVCQRPLEVAPLEEALRLLLVHHD
ALRMRFTRDGEQWLQNGVAPEDAPFSLHQVDLSSTPAAEQPAALEAEASRLQAGFVLSEP
PLLRAALFHLGGGQQRLFLVANHLVVDAVSWRILVEDLESGYTHLAEGRPAVLPPKTTSF
QEWGQRLRTHAASPAILSEAPYWRQTTSAAAPLLPIQASAPNTQALEQRLAFHLEAEETR
LLLQEVPGAWRARIDDVLLTALGQALTGQPEAVIHVEGHGREELFADVDLSRTVGWFTSL
VPFRIHLPERGTTGDALRAVRDARQRRTHHGIGFGLLQSLAPPEVAEGLREQSVPEVTFN
YLGQLDTALAASRLFAWGSESTGPLAAPTGTRLRELEIIASVLGGRLQLTFGYGARRLDE
VTVRALAERLLQHLRTLIAQRHSDDARRFSPGDFPLAALSQQSLDLLLPQVPGAVADIYP
LSPTQQGLLFHALLSPGLDVYLLQNSWAVHAALDTTALEQAWQACLQRHPALRASFHWQG
LDTPVQVVHAQAPTTFAAQDWRGLTPTEQEDRLERFIRDERKAGFDFTRAPLMRLKAFQL
QDDVWRLLFSHHHLMMDGWSLGLVLQEVFALYDAFRASRAPELAARPPFRDYLSWLRSRD
TTADEAFWRDYLAGFTAPTPLPSDTHVTPPPGTHADHPLLEQHLTAEASTTLQDFARQHH
LTLNTVALAAWALVLSRYTGERDVVFGSTLSGRPPELTGSAAMVGMFINTLPIRVRLPGR
DVPLLPWLRSLQEQVAEVRQYEHSTLVDVQTWSELPRGTQLFESLLVVENYPIDEALRRR
SLSLDVRDHRSVERSNYPLGLGIIPGAQVRLLLFHDSPRFQRDAMLRLLDHWRLALEGFS
ARPRGHLDEVSLLSDTERRQLLVEWNPEPRVVSRPPLVHRLFEARVARTPEAPALVHGAE
SLTYGELNARANQLARHLRRLGVGPELLVSLCMERSVDLVVAMLATLKAGGAWLALDPTL
PSERLAFITEDAASPVLITHSSLEHLLDRRGFAVKVDEHADRIERESEDNLDEVLEDARR
LAYVIYTSGSTGRPKGTLLTHGGLCNTATEAGLAHGYREDDRVLQFANASFDASVCEVFA
TLLSGACLVLANQEDLLPPEPLRGLLVGQSITAVTLTPTVLAQLEPRELPLLRTLISAGE
ALPVEVARRWSVGRTLINAYGPTEATICATLSGPVDPEHPSIGRALPGVRVYVLDARLEP
VAPGMDGELYVGGAGVARGYLGRAALTAERFIPDPFSLEPGARLYRTGDKVRWAPRGELE
FLGRFDLQVKLRGFRIELGEIEAVLRAQPGVRDVAVVPREDVPGDKRLVAYVVPSADTEV
HPQSLRSALSSSLPEYMVPAAFVSMDALPRTSSGKVDHRALPAPDGADVAAHEYVAPETA
TQQKLATIWREVLAVEQVGLRDEFMALGGHSLLATQVVSRIRASLGIELPLRALFESSTL
EELARQVDAAAGTAKSPPLPPLRPAAREQHLPLSFSQQRLWFLEQLEPGRATYNMPAAIR
VTGPLDVETFERCVTEMLRRHEVLRTTFHTSGGEAFQVIAPPAPWRLPTHDLSSVPAEQR
EDVARKVALEEGQKPFDLTRGPLLRLTLLKQSDEVHQLVVVMHHIISDGWSITVLIQELS
TLYAAWSQSQPSPLPELPVQYADYAVWQRQWLRGEELERQLAYWRQHLADAPPLLELPTD
RPRPAVQTFRGAAFPVHFDKALSSALKALAQREGVTPFMLVLAIYQLMLSRYSGQRDISV
GSPTAGRRLAELEPLVGFFVNNLVLRTRLDGDPSFRELLGRVWETTLNAYAHQDIPFEKL
VDELRPRRNLGHSPLFQVWFVLDKARLADFTAGPLTLSTVETDAGVSRFDLALFLSDTED
GLTGTLDYNTDLFDASTLARMAEHLRVLMEGIVAAPDARLSSLPMMPAHERRQLLVDGSA
PPRELPQPRLVHRLFEAQAARTPESPAVVHGSESVTYGELNARANQLARHLRRLGVGPEV
LVSICLERSTDYIVAVLATLKAGGAWLPLDPTLPSERLSFITSDAWAPVLITHSSLEHLL
DRRGYVLLMDEHAERFERESDADLDGAMDPAQLAYVIYTSGSTGRPKGTLLTQGGLCNTA
LQTVDFMALGPGHRLLQFFSSAFDASVSELFPALLSGATLVLASREELMPGEPLLTVVRE
QAITTLKVTPSVLAQLDPEGLRDVRTLICAGEAMGAELVERFAPGRRFVNAYGPTEATVC
ATVNAAVQARRVTIGRPFHNVQAYVLDDQGLLVPPGVPGELYLGGMGLARGYLGRPDLTA
ERFVPNPFGTEPGARLYRTGDKVRWLSDGELEYLGRVDFQVKLRGFRIELGEVETVLTQS
PSVREAVVLLREDSPGIKRLVAYVVPGTLDPAALRDVLQQRLPDYMVPAVFVPLEALPLT
ANGKVDRKALPPPDASVKDTFVAPRDEVERHLADIWAQLLGLERVDVHDNFFELGGDSII
SLQVVARARGFGLSLATRDLFQNQTLEALARVARAASTRLVGEQGPVSGAVPLLPVQQHL
LHHDAAHAHHFNQAMLLECREPLSPAHVEEALRHLVTHHDALRLRFTRDDAGRWEQHGVL
PEEAPVTLLQVDLTALPAEEQARAMEAEATRIQAGFTLGQPPLLRAALFHLGVRSQRLLL
VAHHLVVDAVSWRILLGDFESAHARAQEGVDVALPPKSTSYQTWARRLRDYAASEGFATG
VAPWLEAMQRPVVALPTDTPRLDTQGAGQQQEGSLDEETRSSQQREAIQRPVAALPTAPP
GLNTQGSEQRVSVSLDEEETRLLLQDVPGAWRAPINDVLLTALSRTLHEWTGQPRAFIHV
EGHGREDLFSDVDLSRTVGWFTSLVPLHVELPTQGSLGDTLRAVRDTRRLLPHQGIGFGL
LKWMAPTEAAAPAHAWPVPQVAFNYLGQLDGAAASSRLFTLAAEASGPTIAPERTRLHVL
EFNGSVLGGRLQLAVSYSAQLHHESTVRTLASRFVANLRQLISERNSEDARRLSPGDFPL
AALSQSALDTLLHRTGPDLEDLYPLSPTQQGMLFHARLTSGEAAYFEQLSWTVSSPLDMA
AFLDAWRLCIDLHPTLRSSFHWEGLEVPLQAVHARVDLPFAELDWRDVPEAELSARLDQF
LAEDKQRGLDLRRPPLIRLTAFHLGDGTVRFLWSHHHLLVDGWSLGLLIKDVFSLYADLR
TGTKPARAQRPAFREYIAWLQRRESSTDETWWRGYLQGFSAPTPLPGDKRTSPGRSTTAR
HHIMELSLSAPDSSSLQTFARSHQLTLSTLALAAWGLVLARHGGEQDVVFGNTVAGRPAE
LPGADTLVGVFINTLPVRVRLASASSDVLPWLQELQSLQAEQRRFEHSPLVEVQSWSQVP
RGTPLFESLLVFENYPLDSSLLGPDSPVVVRDIQAVESTHYPLTLSVIPSGALRLRAVHD
PARLDDTNVRRLLEHWRQALLSLTRAARLGEVSLLPEDERRQVLLDFNATRADFPADRCI
HHLFEQQATLHPDAIAVEFGDQRLTYRQLDARANQLAWVLREHGVEADSFVALCLERSVE
LIISLLAILKTGGAYLPLDAAYPAQRLAFMLEDAPPRLLLTSKALRSRLPASDSLPSLEI
ETLDLEERPTSPPPVRVTSRHLAYVDFTSGSTGRPKGVAVEHRSVVRLFHGGDYARFGPD
ETFLLIAPISFDASTLEVWGPLLFGGRLVVFPPHPPSDLKLLRDVLERHRVTTLHLTAGL
LTQVVDLEPDALKGVRQLLTGGDVVSAPHVKRVLEEQGLPVTACYGPTEGTLFTSCHRMT
NPDQVGTSVPIGKPIGNTRVYLLDESLRPVPLGAPGELFIGGLGVARGYLSRPDLTAERF
IPDAFDPEPGQRLYRTGDLARWRDDGVLEFLGRGDAQVKLRGYRIELAEVESHLLAHPRV
REAVALVREDAPGDKRLVAYVVPTTGESEGTTASALRTFLQQRLPEFMVPSSFVALDRLP
LTANDKVDRKALPAPEQVSRPAREYEAPRSELEQQLAAICAELLRVGRVGLHDNFFELGG
HSLLATRLVARIRAAFDVDLPLRQLFEAPTVAGLALNVLQLTSGQSPQELTALLEEFEQM
SEAELQALLDDESSSG
NT seq 17691 nt NT seq  +upstreamnt  +downstreamnt
atgaagccctcttcatctgctgctctcgactccacgttgttggatttgcttgaggaacgc
gccggagcaaacgccgaggcgccgctcttcaccttcgtcgaggacagcgacggtgacgaa
gcacggctgagccgtggcgagctgtggcggagggcgcggcgcgtcgcagcggccctgcgg
cagggcgtctcgcccggggagcgagcggtgctgctctacccgccagggctcgagtacgtg
gcgggcttcttcgggtgcatggcctcgggcgtggtggccgtgcccgcctatccgccggac
ccgtcccgcctggagcgcacgctgccgcgcctgcgcgccatcatccaggacgcgcaggcg
gccgtcgtcctcacgacgtccttcatcgtctccatggcggagatgctcttcgaggccgcc
cccgacctgcgagacgtgcgctgggtggccaccgacgagctgcccgagggcctggaggac
acctggcaacggcccgacgtggggcccgactcgctggccttcctccagtacacgtccggc
tccaccggcacgcccaagggcgtggagctcacccacgccaacctgctgcacaacctgcgt
ctcatccatggcgccttccggatgcactccgggagcgcgggcgtcatctggctgccgccg
taccatgacatggggctcatcggcggcatcctcggcaccgtctacggtgggttctccacg
acgctgatgtccccgctgagcttcctgcgcaagcccttgcgctggctcacggcgctctcc
cagacacggggcaccatcagcggagggcccaacttcgcgttcgacctgtgcgtgcgcaag
acgtcggaggtcgagcgtcagtccctggacctgagccactgggacgtggccttctgcggc
gcggagcccatccgcccggagacgctggagcgcttcgtcgaggccttcgccccctgcggc
ttccgccgcgaggccttctatccctgctatggcctggccgaaggcacgctcatcgtctcc
ggcgtggaccagggcaccgtccccgtgctgcgcgacgtcgcggtgcgagcgctgggactg
ggcaccgccgtggcccccgagggcggggagtccgcgcagacgctcgtcggctgtggccat
acgctgccggaccaggatgtcgtcgtggtggaccctcggacccatgcgccgctgcccgcg
gacaccgtgggggagatctgggtgaaggggcccagcgtcgcgcggggctactggcggcgc
gccgaggagagcgagcagaccttccaggcgcgcacgtccacgggcgacggtccgttcctt
cgcaccggagaccacggcttcctccgcgacggcgagctcttcgtcactggccgcctcaag
gacctcatcatcgtccgaggccgcaaccaccacccccaggatgtcgagctgaccgcggag
cgcgcgagccggacgctgcgcccgggctgcggcgcggccttcagccgggagcgcgcgggt
gaagagcggctggtgctggtgtacgaggtggacacccgtcagcagggggagcccatcgag
gaggtggctcgcgccatcacccagcacgtggcggagacccatgagctccagctcgatgcg
ctggtgctcatcgagccgggcagtctgcccaagacctccagtggcaaggtgcagcggcgg
gcctgccgcgcgagcctgttggacggctcgctccgcagcgtggccgcgtgggaagcgagc
acgggcgaggaggagcccgtctccgtcgagacaccaccggacgaggcgccgcgctcggtc
gagggcgtggaggcgtggctgcgcacgcacctggcgcggcggctgggggtttccccctcg
gcgctcgatgcccatgagccgttgacccgccacggtctggattcgctcggggccatggag
ctcgccaacggcatcgagcggggcctgggcatcaccttgcccatggaagccctgctgagc
ggcccgaccctggccgagctcgcggagcgcatctcgcggcacgcggcctcgagcacggcg
ctgtcgctcccccgcgtctctcgcgagcaaccgctcccgctctccttcgcgcagcagcgg
ctctggttcctggagcagctcgagccgggcagccccctctacaacatctccgcgatggtg
cggctggagggcacgctggacgtggcggccctggagcgcgccttcaccgagctgacccgc
cggcatgaatcgctgcgcacgaccttccaggccgactccacgggccaggcctggcagcac
atccacccgcccaccgccctgtcactggcgcgcgtggacctgtcccgacttcctccggga
gagcaggagacggaggtccgccgcgtcgcggaagaggtgtcccggagcgccttcgacctg
acgcgtggccctctgctgcggggcgtcctgctgcgcctgtcggacagcgaccaggtgttg
gtgctctgcgtgcaccacatcgtctcggacggatggtccatggatgtgctcgtgcgcgag
gtgggcgtgctctacgacgccttcgtgcgcggccagacatccccgttgcccgagcccccc
gcgcagtacgtcgaccatgcctgctggcaacgtgagcaactccagggcgacgcactgacg
cgccagctcgactggtggaagcagcagctcgccggcgcccccgcgcacctggagctgccc
ggcgacagaccacggcgccccgtgcggagcattctcggcgcaagccagcccctgcacctc
tccgcggagtcgtggacgcggctgcgcgccatggcccagcgggaagacgtcaccccgttc
atggtgctgctcgcggccttccaggcgctgctgcatcgctacagcgggcaggaggacctc
tgcgtcggcgctcccatcgcgggccgcacccggggcgtgacggagggcctcatcggcttc
ttcgtcaacacgctggtgctgcgctcgcgcttcacctcggacacctccttccgcgccctg
ctgggccaggtccgggacacgacgctgggggcctatgcccaccaggacgtccccttcgag
aagctggtggacgaactgagccccgtgcgtgagctcggccagaccccgctcttccaggcg
atgctggtgctccagccggatcccctggcgaagctcacgctgccgggtctgtccctgcgc
cgactgccgctgcacacccagacctcgaagttcgacctctccctcgcggtcagcgagttc
gagggagggctgacgggcagtctcgacttcgcgacggacctgttcgagcccgccaccgcc
gcgcgcctggtggagcacctgctcacgctgctcgaggcggccgtcgacgcacccgagacc
cgcgtgggagcgctgcccctcttcggcgacgccgagcgcgcgcggctgctggagcacttc
gcgaccgaggccacttcattccctgcccgtgactccgtgctcgcgctcatcgaggagcag
gcggcgcgccaccccgaacggcccgccgtcgcctgcgaggagcagcgactcacctacgcg
cagctcgacgcgcgcgccaaccagctcgcctggcaccttcgcgcgtcgggcatcggcggc
gaagaccgggtcgccgtgtgcttggagcgctccgtcgacaccgtcgtcgccttgctgggc
atctggaaggcaggggcggcctacgtcccgctggacccggagtggcccccgtcgcgacgc
gagtccctggtgcgcgcggtctccgtccaggccgtcgtcaccacctccccgcatgcggcg
gggatggcctcggcatcggtgcccctggttgagctggacacgctggccgagcacctctcc
gacctgagcacctcgcggcccggggcctcgctgctgccccagcacgtcgcctatgtgctc
ttcacctcgggctccacgggccagcccaagggtgtcgccgtcgcgcatgcgcagttgctg
aactacgtccaggcggccacgcagcggctggacctggaggcgtgcgagagcttcgccctc
gtgtccacgttcgtcgcggacctgggcaacaccgtgctgttcccggccctgtgcctcggc
gggctgctgcatgtgctcacgcgtgagcgcgcggccaaccccgagggcgtggccgagtac
gtccagcgacaccccatcgactgcatgaaggtcgtgccgtcgcacctcgccgcgctgatg
acggcgccccagccgtcgcgggtgctccctcgcaagcggctggtgctgggaggcgaagca
ccctcctggtccctcgttgaagaggtgcatcggctggcccctcgctgcgaggtgcacaac
cactacggccccaccgagacgacggtgggcgtgctggcggggcgcgtgtccttcacgcag
ccaacctccgccgcggtgcccctggggcgcccgctggcgaacacccgcgcctacgtgttg
gacgcgggcctgcggctggtgcccatcggcgtgcctggcgagctgtacgtgggtggagac
caggtcacccgaggctatgccgcccagccgggcctgacggcggagcggtacatgccggac
ccgtacagcccgaagcccggcgcgcgcatgtaccgcactggagaccgggtgcgatggctg
gcggacgggcggctggagttcctcggccgcgtcgacttccaggtgaagctgcgcggcttc
cgcgtggagccgggtgaagtggagaaggtgctggagcggcatgaggccgtgaggcaggcc
gtcgtcgtggtgcgcgagcccacaccgggccaccctcgcctcgtcggctacgtcgtcccg
cgcgccccctctggcgtggacacgcgggccctgcgcgccttcctccagtcccaggtgccc
gagtacatggtgccctcggcgctcgtggtgctggaggcgctcccgctcaacgccaacggc
aagctcgaccgccaggccctgcccgcgcccgaggcttccgacaccccgacgagcagtttc
atcgccccgcgggacgaggtggagcaacgcctggccggcatctgggcgcaggtgctgggt
ctggcgcgggtcggtgtccacgacaacttcttcgagctgggcggcgactcgatcatcagc
ctccaggtggtggcccgggcccggcaggccggcatctccctggccacgcgcgacctcttc
cagcatcagacgctggaggcgctcgcgcgggtggctcgcgccgtcccccaggccgcggcc
gccgcggaacagggccccgtcacgggcccggccgtgctgacgcccatccaacggcacctg
ctgcgacacgggtccgaacacgcgcaccactacaaccaggccgtgctcctggtctgtcag
cgtcccctggaggtcgcgccgctcgaagaggccctccgcctcctcctcgtccaccacgat
gccctgcgcatgcgcttcacgcgggacggagagcagtggctccagaatggcgtcgcgccc
gaggacgcccccttctccctgcatcaggtggacctgtcctccacaccggccgccgagcag
cccgcggccctggaggccgaggcttcgcgactccaggccggcttcgtcttgagcgagccc
ccgctgttgcgcgccgccctcttccacctcggtgggggccagcagcggctgttcctcgtg
gcgaaccacctggtcgtggacgcggtctcctggcgcatcctcgtggaggatctcgagtcc
ggttacacgcacctggcggagggccgccccgccgtccttcccccgaagaccacgtccttc
caggagtggggccagcggctgcgaacccatgcggcgtctccagcgatactgagcgaggcg
ccgtactggcgtcagaccacgagcgccgccgcccccctcctgcccatccaggcctcggca
cccaacacccaggcgctcgagcagcggctggccttccacctggaggcagaggagacgcgg
ctgctcctccaagaggttcccggagcctggcgcgcgcgcatcgacgacgtgctgctcacg
gcgctcgggcaggcgctcacgggccaacccgaggccgtcatccatgtggagggacacggc
cgggaagagctcttcgccgacgtggacctgtcgcgcaccgtgggctggttcacctcgctg
gtgcccttccgcatccacctgcccgagcgcggaacgacgggcgatgccctgcgcgcggtg
cgggacgcgcgtcagcggcggacccatcacggcatcggcttcgggctgctccagtccctc
gcgcctcccgaggtggctgagggcctgcgcgagcagtccgtgccggaggtgacgttcaac
tatctgggccagctcgacaccgcgctggccgcgagccgcctcttcgcgtggggctccgag
tccaccggcccgctcgccgcgcccaccggcacccggcttcgcgagctggagatcatcgcc
tccgtgctcgggggccggctgcagctcaccttcgggtacggcgctcgacgactcgacgag
gtcaccgtccgcgcgctggccgagcgcctgctccaacacctgcgcacgctcatcgcccag
cgtcactccgacgatgcgcggcgcttctcgccgggggacttccccctggccgccctgtcc
cagcagtcgctcgacctcctgttgccacaggtgcccggggcggtcgcggacatctatccg
ctgtcccccacgcagcagggcctgctcttccatgccctgctgtcaccggggttggacgtc
tacctcctccagaactcgtgggccgtccacgccgcgctggacacgacggcgctggagcag
gcgtggcaagcctgcctccagcgacaccccgccctgcgcgcctcgttccactggcaaggg
ttggacacgcccgtgcaggtcgtccacgcccaggcaccgacgactttcgcggcgcaggac
tggcgcggcctcacgccgacggagcaggaggaccgcctcgagcgcttcatccgagatgaa
cggaaggcgggcttcgacttcacccgcgcgccgctgatgcgcttgaaggcattccagctc
caggatgacgtgtggcgcctgctcttcagccaccaccacctgatgatggacggctggagc
ctgggcctggtgctccaggaggtcttcgcgctctacgacgccttccgcgcgagccgcgct
ccggagctggccgcgcggcctcccttccgggactacctctcctggctgcggagccgggac
accaccgccgacgaagccttctggcgcgactacctagcgggcttcaccgctcccacgccc
ctgccctcggacacccacgtcacgccgcctcctgggacccacgccgaccatccgctgctc
gagcaacacctcaccgccgaggccagcaccaccctccaggacttcgcccgtcagcaccac
ctcaccctcaacaccgtcgcgctggcggcctgggccctggtgctctcgcgctacaccggt
gagcgggacgtcgtcttcgggagcacgctctccggacgccccccggagctgaccgggtcc
gcggcgatggtgggcatgttcatcaacacgctgcccatccgcgtccggctgccgggccgt
gacgtcccgctgctgccctggctgcgctcgctccaggagcaggtcgcggaggtgcgacag
tacgagcactccacgctcgtcgacgtccagacgtggagcgagctgcctcgaggaacgcag
ctcttcgagtcgctgctcgtcgtcgagaactaccccatcgacgaggcgctgcgccggcgc
tccctcagcctcgacgtgcgcgaccaccgctccgtcgagcgctccaactatcccctcggc
ctcggcatcatcccgggcgcccaggtgcggctgctcctgttccacgactcgccccgcttc
cagcgggacgcgatgctgcgactgctcgaccactggcgcctggcgctggagggattttcg
gcccggcctcggggacacctggacgaggtgtccctgctctccgacaccgagcgccgccag
ctcctggtcgagtggaaccccgagccccgcgtcgtctcgcgtcccccgctggtgcaccgc
ctcttcgaggcccgcgtcgcacgcacgccggaggcccccgcgctcgtgcatggcgccgag
tcgctgacctacggcgagctcaacgcccgcgccaaccagctcgcccggcacctgcgccga
ctgggcgtcggccccgagctgctcgtctccttgtgcatggagcgctccgtcgacctcgtc
gtcgccatgctggccacgctcaaggccggtggcgcctggctcgcgctggaccccacgctg
ccctccgagcgcctggccttcatcaccgaggacgccgcgtcgcccgtgctcatcacgcac
tcctcgctggagcacctgctcgaccggcgcggcttcgcggtgaaggtcgacgagcacgcg
gaccgcatcgagcgggagtccgaggacaacctggacgaggtgctggaggacgcacgcagg
ctcgcctacgtcatctacacctccggctccacgggccggcccaagggcaccctgttgaca
catggtggcctctgcaacaccgccacggaagcaggactcgcccacggctaccgcgaggac
gaccgggtgctccagttcgccaacgcgagcttcgatgcctccgtctgcgaggtgttcgcc
accctcctgtccggcgcctgcctggtcctggcgaatcaagaggacctgctcccaccggag
cccctgcgcggcctgctggtcgggcagtccatcaccgcggtgacgctgacgcccaccgtg
ctcgcgcagttggagcctcgggagctgccgctcctgaggaccctcatctccgccggcgag
gccctgcccgtcgaagtcgcgcgacggtggagcgtgggtcgcacgctgatcaacgcgtat
ggccccacggaagccaccatctgcgccaccctcagcggccccgtggaccccgagcacccg
agcatcggccgggcgctgccgggcgtgcgggtctacgtcctggatgcgcgcctggagccc
gtggcgccgggcatggatggagagctctacgtcggcggcgcgggcgtggcccgaggctac
ctgggacgtgcggcgctcaccgcggagcgcttcatccccgaccccttcagcctcgagccg
ggcgcgcgcctgtaccgcacgggcgacaaggtccgctgggcgccgcgaggcgagctggag
ttcctgggccgcttcgacctccaggtgaagctgcgcggcttccgcatcgagctgggagaa
atcgaagccgtgctgcgcgcgcagccgggcgtgagggacgtcgccgtcgtcccgcgcgag
gatgtccctggcgacaaacgcctggtcgcgtacgtggtgccctcggcggacacggaggtc
catccccagtcgctgcgctccgcgctgtcgtcgagcctgcccgagtacatggtgcccgcg
gccttcgtgtcgatggacgccctgccacgcacctccagcggcaaggtcgaccaccgcgcc
ctgccggcaccggacggcgcggacgtcgcggcccacgagtacgtcgcccccgagacggcg
acgcagcagaagctggccaccatctggcgcgaggtcctggccgtcgagcaggtgggtcta
cgcgacgagttcatggcgctcggcggccactcgctgctggccacccaggtcgtctcacgc
atccgcgcctcgctgggcatcgagctgccgctgcgcgccctcttcgagtcctccaccctg
gaggagctggcccgacaggtggatgccgccgcgggcaccgcgaagtcccccccgcttccg
cccctgcggcccgcggctcgggagcagcacctgccgctgtccttctcccagcagcggctg
tggttcctggagcagctcgagcccgggcgcgcgacgtacaacatgcccgccgccatccgc
gtgacggggcccctggacgtcgagacgttcgagcgctgcgtgacggagatgctccgcagg
catgaagtcctgcggaccacgttccacacctccggaggcgaggcgttccaggtcatcgcc
ccacccgccccctggcgactgccgacccacgacctctcctccgtgcccgcggagcagcgc
gaggacgtggcgcggaaggtggcgctggaggaaggccagaagcccttcgacctcacgcgc
ggcccgctgctgcggctgaccctgctgaagcagtcggacgaagtgcaccagctcgtggtg
gtgatgcaccacatcatctccgatgggtggtccatcaccgtgctcatccaggagctgagc
accctgtacgccgcctggtcccagagccagccctccccgcttcccgagctgcccgtccaa
tatgccgactacgcggtgtggcagcgccaatggctgcgaggcgaggaattggagcggcag
ctcgcgtactggcgccagcacctcgcggatgcgccaccgctgctggagctgccgacggac
cggccccggcccgcggtccagacgttccgaggcgccgcgttcccggtgcacttcgacaag
gccctgagcagcgcgctcaaggccctggcgcagcgcgagggtgtcacgcccttcatgctg
gtgctggccatctaccagttgatgctctcgaggtactcgggccagcgggatatcagcgtg
ggctctcccaccgccgggcgccggctcgccgagctcgagccgctcgtgggcttcttcgtc
aacaacctggtgctgcgcacgcggctcgacggtgacccctccttccgtgagctgctcggg
cgcgtctgggagacgacgctgaacgcgtatgcccaccaggacatcccgttcgagaagctg
gtggacgagctgcggcctcggcgcaacctgggccacagcccgctcttccaggtgtggttc
gtgctcgacaaggcccgcctcgcggacttcaccgcgggcccgctgacgctgagcaccgtg
gagaccgacgcgggagtgtcccggttcgacctggccctcttcctgtcggacaccgaggac
gggctcaccggcaccctcgactacaacaccgacttgttcgacgcctccaccctcgcgcgg
atggcagagcacctgcgcgtgttgatggagggcatcgtcgccgcgcccgatgcgcgcttg
tcgagcctgccgatgatgccggcccacgagcgccgccagctcctggtggacgggagcgcc
ccgccccgggagctgccccagccgcgcctggtgcaccgcctcttcgaggcccaggcggcc
cggacaccggagtccccagccgtcgtgcacggctcggagtccgtcacctacggagagctc
aacgcgcgcgccaaccagctcgcgcggcacctgcgccgactgggcgtgggcccggaggtc
ctcgtctccatctgcctggagcggtccaccgattacatcgtcgccgtgcttgccacgctc
aaggcagggggcgcctggctcccgttggaccccacgttgccctccgagcgcctgtccttc
atcacgtcggatgcctgggcgcccgtcctcatcacccactcgtccctggagcacctgctc
gaccgccgtggctacgtcctcctgatggatgagcacgcggagcgcttcgagcgggagtcc
gacgcggacctcgatggggcgatggacccggcgcagctcgcctatgtcatctacacctcc
ggctccacgggccggcccaaggggacgctgctgacgcagggcggcctctgcaacaccgcg
ctccagaccgtggacttcatggccctggggcccggccatcggctgttgcagttcttctcg
tcggccttcgacgcctcggtctcggagctcttccccgcgctgttgtcgggggcgacgctg
gtgctggcctcgcgcgaggagctgatgccgggtgagccgctgctgaccgtggtgcgtgag
caggccatcaccacgctgaaggtcacgccgtccgtgctggcccagctcgacccggaggga
ctgcgcgacgtgcgcacgctcatctgcgcgggcgaggccatgggggcggagctggtggag
cgcttcgcgccggggcggcggttcgtcaacgcgtatggacccacggaggccactgtctgt
gccacggtgaacgcggcggtgcaggcgcggcgggtcaccatcggtcggcccttccacaac
gtccaggcgtacgtgttggacgaccagggactgctggtgcctcctggagtgccgggcgag
ctgtacctcgggggcatgggcctggcccgtggatacctcgggcggccagacctcaccgcc
gagcgcttcgtcccgaatcccttcggcaccgagcccggcgcacggctgtatcgcacgggt
gacaaggtgcgctggctgtccgacggggagctggagtacctgggccgcgtcgacttccag
gtgaagctgcgcggcttccgcatcgagctgggcgaagtggagacggtgctgacccagtcg
ccctccgtgcgcgaggcggtggtgttgctgcgcgaggactcaccgggcatcaagcggctg
gtcgcgtatgtcgtcccgggcacgctcgacccggcggcgctgcgggacgtcctccagcag
cggctgcccgactacatggtgccggccgtcttcgtcccgctggaggccctgcctctgacc
gccaacggcaaggtggaccggaaggcgctgccgccgccggatgcctccgtgaaggacacg
tttgtcgccccgcgcgacgaggtggagcggcacctggccgacatctgggcccagctcctg
gggctcgagcgagtcgacgtccacgacaacttcttcgagctgggcggcgactccatcatc
agcctccaggtggtcgcccgtgcgcgggggttcggcctctcgctggcgacgcgagacctc
ttccagaaccagacgttggaagccttggcgagggtggcgcgagccgcgtcgacccggctc
gtgggtgagcagggtcccgtgtccggggcggtgccgctgctgcccgtgcaacagcacctg
ctgcatcacgacgccgcccatgcgcaccacttcaaccaggcgatgttgctggagtgccga
gagccactcagccccgcgcatgtcgaggaggccctgcgccacctggtcacccaccacgat
gccctgcgtctgcgcttcacccgggacgacgcggggagatgggagcagcacggggtcctg
cccgaagaggctcccgtcaccctattgcaggtggacctgaccgcgcttccggccgaggag
caggcacgcgcgatggaggcggaggccacgcggatccaggcgggcttcacgctgggtcag
ccgcccttgctgcgtgccgccctcttccacctgggagtccgttcacaacgcctgctcctc
gtggcccaccacctggtggtggacgccgtctcgtggcgcatcctcctgggggacttcgag
tccgcccatgcgcgcgcgcaggagggagtggacgttgccctgcctccgaagagcacctcg
taccagacctgggcccgacggctccgcgactacgcggcctcggagggcttcgcgacgggc
gtcgccccctggctcgaggcgatgcagcggccggtggtcgctctgccaaccgacacccct
cgcctcgacacccagggcgctgggcagcaacaggaaggcagcctcgatgaggaaacgcgc
tcgtcgcagcaacgcgaggcgatacagcggccggtggccgctctgccgaccgccccccct
ggcctcaacacccagggctccgagcaacgggtgtcggtcagcctcgatgaggaggagaca
cgccttctgttgcaggacgtgcccggtgcctggcgtgcccccatcaacgatgtgctgctc
accgccctgagccgcaccctccacgagtggacgggccagccacgcgccttcattcacgtg
gagggccatggccgtgaggacctcttctccgacgtggacctgtcgcgcacggtagggtgg
ttcacctcactggtaccgctccacgtggagctgcctacccaaggctccctgggtgacacg
ctccgcgccgtgcgcgacacgcgccgccttctgccgcatcagggcatcggcttcggcctg
ctcaagtggatggcgcccaccgaggccgccgcgcccgcccacgcctggcccgttccacag
gtggccttcaactacctgggccagttggacggcgccgcggcctccagccggctgttcacc
ctggccgcggaggccagcgggcccaccatcgcgcccgagcgcacccgtctgcacgtgctg
gagttcaacggctcggtcctcggaggcaggctccagctcgccgtcagctacagcgcccag
ctccaccacgagtccacggtgcgaacgctggcatcgcgcttcgtcgcgaacctgcgccag
ctcatctcggagcggaactccgaggacgcgcgccggctctcaccgggtgacttccccctc
gccgccctgtcccagtccgcactcgacacactcctgcatcgcaccggcccggacctcgag
gacctctaccccctgtccccgacgcagcagggcatgctcttccatgcacggctcacctcg
ggcgaagccgcgtacttcgagcagctgtcctggacggtctcctctccgctggacatggcc
gccttcctcgatgcgtggcgtctctgcatcgacctgcaccccaccctccgctcgtccttc
cactgggaagggctcgaggttcccctccaggcggttcacgcccgggtggacctgccgttc
gcggagctcgactggcgcgacgtgcccgaggcggagctgtccgcgcgcctcgatcaattc
ctcgccgaggacaagcagcgcggactggacctgcgtcggccgcccctcatccgactcacc
gcgttccacctcggtgacggcacggtccgcttcctctggagccaccaccacctgctggtg
gacggttggagcctggggctgctcatcaaggacgtcttctcgctctacgccgaccttcgc
accggcacgaagccagcacgtgcgcagcgcccggcgttccgcgagtacatcgcctggctg
caacgccgggagtcttccacggacgaaacctggtggcggggttacctccagggcttcagc
gcgcccacgccgctccccggagacaaacgaacgtcacctgggcgaagcaccaccgcacga
catcacatcatggagctgagcctgtccgccccggactcgtcctcactccagaccttcgcg
cggagtcatcagctcaccttgtccaccctcgccctcgcggcctggggcctggtcctcgcg
cgccacggcggcgagcaggacgtcgtcttcggcaacaccgtggcgggaagacccgcggag
ctgcccggcgccgacaccctggtgggcgtgttcatcaacacgctgcccgtccgcgtgcgg
ctcgcctccgcctcctcggacgtgctgccctggctccaggaactccagtccctgcaagcc
gagcagcgtcggttcgagcactcccccctcgtcgaggtgcagtcctggagccaggtgccc
cgaggcacgccgctcttcgagtcgctgctcgtcttcgagaactaccccctggactcctcg
ctgctcggccccgactcacccgtggtggtgcgagacatccaggccgtcgagtccacccac
tacccgctcacgctctcggtcatccccagcggagccctccgcctgagggccgtgcatgac
ccggcccgcctcgacgacacgaacgtgcggcggctcctggagcactggcgacaggccctg
ctatcgctgacccgcgccgcgcgactcggtgaggtctccctgctcccggaggacgagcgc
cgtcaggtgctcctggacttcaacgccacccgcgcggacttccccgccgaccgctgcatc
caccacctcttcgagcagcaggccacgctgcatccggacgccatcgcggtggagttcggc
gaccagcggctcacgtatagacaactcgacgcacgcgccaaccagctcgcgtgggtgctc
cgcgagcacggcgtggaggccgacagcttcgtcgcgctctgcctggagcgctcggtggag
ctcatcatctcgctcctggccatcctcaagaccggtggtgcgtacctgcccttggacgcg
gcctatccagcccagcgccttgccttcatgctcgaggacgcgccgccgcgactgctcctc
acctcgaaggccctgcgctcccgtctccccgcctccgactcgctgcccagcctggagatc
gagacgctggacctggaagagcgccccacctcgccgccgcccgtccgagtcacctcgcgc
cacctcgcctacgtcgacttcacgtccggctccaccggccggcccaagggcgtcgccgtc
gagcaccgctccgtggtccgcctcttccacggcggcgactacgcgcggttcggacccgac
gagaccttcctcctcatcgcgcccatctccttcgacgcctccacgctggaagtctgggga
ccgctcctcttcggcggacggctggtcgtcttcccgccgcacccccccagcgacctcaag
ctgctgcgcgatgtcctcgaacggcatcgcgtcaccaccctccacctcaccgcgggactg
ctcacccaggtggtggacctggagcccgacgcgctgaagggcgtgcgccagctcctcacg
gggggagacgtcgtctcggcgccgcacgtgaagcgagtgctcgaggagcaaggcctcccc
gtgacggcctgctatgggcccacggagggcaccctcttcacgtcctgccatcgcatgacg
aacccggaccaggtgggcacgtcggtgcccatcggcaagcccatcgggaacacgcgggtg
tacctgctggacgagtccctgcggcccgtccccctgggcgcgccgggcgagctcttcatc
ggtggcctgggcgtggcacgaggttacctgtcccgccccgacctcaccgccgagcgcttc
atccccgacgccttcgaccccgagcccggtcagcgcctgtaccgcaccggcgacctggca
cgctggcgcgacgacggagtgctcgagttcctcggccgaggcgacgcccaggtgaagctg
cgcggctaccgcatcgagctggccgaagtggagtcccacttgctggcccatcctcgggtc
cgcgaggccgtcgccctcgtccgtgaggacgcgcctggagacaagcgcctcgtggcctac
gtcgtccccaccaccggtgagagcgagggcacgacggcctccgcgctgaggaccttcctc
cagcagcggctccccgagttcatggtgccctccagcttcgtggccctggaccgcctgccc
ctgaccgccaacgacaaggtggaccgcaaggccctgcccgctccggagcaggtctcgcgc
ccggcacgcgaatacgaggcccctcgcagcgagctcgagcagcagctcgccgccatctgc
gcggagctcctccgcgtcgggcgggtcggcctgcacgacaacttcttcgagctgggaggc
cactcgcttctggccacccggttggtggcgcgaatccgcgcggccttcgacgtggacctg
cccctgcgtcagctcttcgaggcccccaccgtggccgggctcgcgctgaacgtcctccag
ctcacctccggccagtcaccccaggagctcacggcgctgctggaggagttcgagcagatg
agcgaggcggagctccaggccctgctggatgacgagtcctcgtcgggatga

DBGET integrated database retrieval system