KEGG   Myxococcus stipitatus: MYSTI_06191Help
Entry
MYSTI_06191       CDS       T02436                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
msd  Myxococcus stipitatus
Pathway
msd00473  D-Alanine metabolism
msd00550  Peptidoglycan biosynthesis
msd01100  Metabolic pathways
msd01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:msd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    MYSTI_06191
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    MYSTI_06191
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    MYSTI_06191
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:msd01011]
    MYSTI_06191
Enzymes [BR:msd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     MYSTI_06191
Peptidoglycan biosynthesis and degradation proteins [BR:msd01011]
 Precursor biosynthesis
  Amino acid ligase
   MYSTI_06191
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N GARS_A ATP-grasp_4 CPSase_L_D2 RimK ATP-grasp ATPgrasp_ST ATPgrasp_Ter ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: AGC47464
UniProt: L7ULX0
LinkDB All DBs
Position
complement(8033378..8034334)
Genome map
AA seq 318 aa AA seqDB search
MTVIRGAFSKDELKHKRVGVLYGGLSAEREVSLRTGAAVAEALRSLGYTVVDIDVGKDLP
ARLVAEKVDVAWLAVHGRYGEDGSLQGLLESMFIPYTGSGVLASALGMDKVYAKQVFVAH
DIPTPAYRAFQDEASALAAGDSLPFPFPVVVKPSREGSSVGVHICKTRDAYDAAVRDAAK
YAGTLLVEQFVKGREVQGGVLDDEALGVIEVRAAREFYDYDAKYKAGTGTQYLFPAPLPP
DQYARVNEVCLGAHRALGCAGGSRSDVIVTEGGAVFLLETNTLPGMTATSLLPKIAAGRG
IDFPSLCERLLQGACLKA
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgacagtcattcgcggtgccttcagcaaggacgaactcaagcacaagcgcgtgggcgtg
ttgtacggcggcctctccgccgagcgcgaagtgtccctgcgcaccggcgccgccgtggcc
gaggcgctgcgctcgctgggctacaccgtggtggacatcgacgtgggcaaggacctgccc
gcgcgcctcgtcgcggagaaggtggacgtggcgtggctggcggtgcacggccgctacggc
gaggacggcagcctccagggactgctcgagtccatgttcattccctacacgggcagcggc
gtgctggcctccgcgctgggcatggacaaggtctacgccaagcaggtgttcgtggcgcat
gacatccccacgcccgcctaccgcgcgttccaggacgaggcctccgcgctggcggcgggg
gactcgctgccgtttcccttccccgtcgtcgtgaagcccagccgagagggcagcagcgtg
ggcgtgcacatctgcaagacgcgcgacgcgtatgacgccgcggtgcgggatgctgcgaag
tacgcgggcaccctcctggtggagcagttcgtcaagggccgcgaagtccaaggtggagtc
ctggacgatgaggcgctcggtgtcatcgaggttcgcgccgcacgcgagttctacgactac
gatgcgaagtacaaggcgggcactggaacgcagtacctcttccccgcgccccttcctccg
gatcagtatgcacgggtcaacgaggtatgcctgggcgcgcaccgggccctgggctgtgca
ggggggtcgcgctcggatgtcatcgtcaccgagggaggcgctgtgttcctgctggaaacc
aacacgctgccgggcatgacggccaccagcctgctgcccaagattgcggctggacgcggt
atcgacttcccgtccttgtgcgagcgcctgttgcaaggggcctgtctcaaggcttag

DBGET integrated database retrieval system