KEGG   Myxococcus stipitatus: MYSTI_06737Help
Entry
MYSTI_06737       CDS       T02436                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
msd  Myxococcus stipitatus
Pathway
msd00480  Glutathione metabolism
msd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    MYSTI_06737
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:msd02000]
    MYSTI_06737
Enzymes [BR:msd01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     MYSTI_06737
Transporters [BR:msd02000]
 Other Transporters
  Pores ion channels [TC:1]
   MYSTI_06737
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_C_3 GST_C_2 GST_N_3 GST_N GST_N_2 GST_C_6 Tom37
Motif
Other DBs
NCBI-ProteinID: AGC48010
UniProt: L7UJE7
LinkDB All DBs
Position
8663703..8664311
Genome map
AA seq 202 aa AA seqDB search
MKLYYTPGACSLSPHIILREAGLKFAVEKVDLRSKKTETGVDFNTVNPKGYVPTLVLDNG
AMLTEGPAIVQYLADQAPESKLAPANGTFERYQLQEMLNFISTELHKAFSPLFNPAFPDD
GKRIFRDRIAQRLTTLNGLLEKNAFLMGEQFTVADAYLFTVLNWTRPMQIDLEPYPFVKA
YHGRIAARPHVQAALAAEGLTK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaagctctactacacgccgggtgcctgctccctgtctccgcacatcatcctgcgcgag
gcgggattgaagttcgctgtcgagaaggtcgacctgcgctccaagaagacggagaccggc
gtggacttcaacaccgtcaaccccaagggctatgtgcccacgctcgtgctcgacaacggc
gcgatgctgacggaagggcccgccatcgtgcagtacctggcggaccaggcgccggagagc
aagctcgccccggccaacggcacgttcgagcgctaccagctccaggagatgctcaacttc
atctccaccgagctgcacaaggccttcagccccctgttcaaccccgcgttccccgatgac
ggcaagcgcatcttccgcgaccgcatcgcgcagcggctcacgacgttgaacgggctgctc
gagaagaacgcgttcctgatgggggagcagttcaccgtggcggatgcctacctcttcacg
gtgctgaactggacgcggcccatgcagatcgacctggagccctaccccttcgtgaaggcc
taccatgggcgcatcgccgcgcggccgcacgtgcaggcggcgctggcggccgaagggctg
acgaagtga

DBGET integrated database retrieval system