KEGG   Myxococcus stipitatus: MYSTI_07775Help
Entry
MYSTI_07775       CDS       T02436                                 

Definition
(GenBank) superoxide dismutase, Fe
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
msd  Myxococcus stipitatus
Brite
Enzymes [BR:msd01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     MYSTI_07775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AGC49047
UniProt: L7UN91
LinkDB All DBs
Position
complement(9922339..9922926)
Genome map
AA seq 195 aa AA seqDB search
MPFALPELPYKKDALAPHMSEETFSYHYDKHHAAYVNNLNKLLDGKPEASKSLEEIILSS
DGGVFNNAAQVWNHTFFWNCMKPKGGGEPTGDLLAAINRDFGSFAKFKEDFSTAAATQFG
SGWAWLVADKDGKLAVTKTSNADLPMKHGQKALLTIDVWEHAYYIDYRNLRPKFIETFLN
HLVNWDFVAQNLKAR
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgcccttcgccctgcccgaactcccgtacaagaaggacgcgctggctcctcacatgagc
gaggagaccttctcgtaccactacgacaagcaccacgccgcctacgtcaacaacctgaac
aagctgctggatggcaagcccgaggcgagcaagtcgctggaggagatcatcctgagcagc
gacggtggcgtgttcaacaacgcggcgcaggtctggaaccacaccttcttctggaactgc
atgaagcccaagggcggcggtgagccgacgggcgacctgctggcggccatcaaccgggac
ttcggctccttcgccaagttcaaggaggacttctccaccgccgccgcgacgcagttcggc
tccggctgggcgtggctggtcgcggacaaggacggcaagctggccgtcaccaagacgagc
aacgcggacctgccgatgaagcacggccagaaggccctgctgaccatcgatgtgtgggag
cacgcctactacatcgactaccgcaacctgcggccgaagttcatcgagacgttcctgaac
cacctggtcaactgggacttcgtcgcccagaacctgaaggcccgctag

DBGET integrated database retrieval system