KEGG   Microbacterium sediminis: E3O41_01080
Entry
E3O41_01080       CDS       T06576                                 

Definition
(GenBank) DNA-3-methyladenine glycosylase
  KO
K03652  DNA-3-methyladenine glycosylase [EC:3.2.2.21]
Organism
msed  Microbacterium sediminis
Pathway
msed03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:msed00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    E3O41_01080
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:msed03400]
    E3O41_01080
Enzymes [BR:msed01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.21  DNA-3-methyladenine glycosylase II
     E3O41_01080
DNA repair and recombination proteins [BR:msed03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     E3O41_01080
 Prokaryotic type
     E3O41_01080
SSDB
Motif
Pfam: Pur_DNA_glyco
Other DBs
NCBI-ProteinID: QBR73165
UniProt: A0A1B9NAJ0
LinkDB
Position
220039..220719
AA seq 226 aa
MSGLRPATRDDLLPLAVEVAPRLLGAVLTTTIAGETVAVRITEVEAYHGAGSGAVPDPGS
HARMGRTARNATMWGEPGHLYVYLSHGIHSCVNVVCGPEGRGDGCLLRAGEIIGGADIAR
RRRTVRGVVRSDRDLARGPGRLGDAIGLRHPLHDGIDAIGGAELGGAVARLELAAEPVAD
PAAGPRVGVAGVAGTSAYPWRFWIAGDPTVSAFRPGRGAVEAAGPC
NT seq 681 nt   +upstreamnt  +downstreamnt
gtgagtgggctgcgcccggccacgcgcgacgacctgctgccgctcgccgtcgaggtggcc
ccgcggctgctgggcgccgtgctgaccaccacgatcgccggcgagacggtggccgtgcgc
atcaccgaggtggaggcgtatcacggcgccggctcgggggcggtccccgaccccggctcg
cacgcccgcatggggcgcacggcgcgcaacgcgacgatgtggggcgagcccggtcacctg
tacgtgtacctcagccacggcatccactcgtgcgtcaacgtcgtctgcggccccgagggg
cgcggcgacggctgcctgctgcgggcgggcgagatcatcggcggcgccgacatcgcccgc
cgacgccgcaccgtgcgcggcgtcgtgcgcagcgaccgcgacctcgcgcgcggccccggg
cgcctcggcgacgccatcggcctgcgccatccgctgcacgacggcatcgacgcgatcggg
ggtgccgagctcggcggcgcggtcgcgcggctcgagctcgccgccgaacctgtggccgat
cccgcggccggtccgcgcgtgggcgtggcgggcgtggccggcacctcggcgtacccgtgg
cggttctggatcgccggggatcccaccgtgtcggccttccgcccgggacgcggggcggtc
gaggccgcggggccgtgctag

DBGET integrated database retrieval system