KEGG   Mycolicibacterium smegmatis MC2 155: MSMEI_0444Help
Entry
MSMEI_0444        CDS       T02191                                 

Definition
(GenBank) DNA topoisomerase (ATP-hydrolyzing)
  KO
K02470  DNA gyrase subunit B [EC:5.6.2.2]
Organism
msg  Mycolicibacterium smegmatis MC2 155
Brite
KEGG Orthology (KO) [BR:msg00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:msg03032]
    MSMEI_0444
   03400 DNA repair and recombination proteins [BR:msg03400]
    MSMEI_0444
Enzymes [BR:msg01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.2  DNA topoisomerase (ATP-hydrolysing)
     MSMEI_0444
DNA replication proteins [BR:msg03032]
 Prokaryotic type
  DNA Topoisomerases
   MSMEI_0444
DNA repair and recombination proteins [BR:msg03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHIIR (short-homology-independent illegitimate recombination)
     Facilitator
      MSMEI_0444
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_gyraseB_C DNA_gyraseB Toprim HATPase_c HATPase_c_3
Motif
Other DBs
NCBI-ProteinID: AFP36925
UniProt: A0QPN2
LinkDB All DBs
Position
complement(533759..535792)
Genome map
AA seq 677 aa AA seqDB search
MSYTAADITELDDVQHTRLRPAVNLGLDVLNTALREIVDNAIEEVADPGHGGSTVTITLH
ADGSVSVADDGRGLPVDTDPTTGKNGIVKTLGTARAGGKFSAHKDATSTGAGLNGIGAAA
AVFISARTDVTVRRDGKTFLQSFGRGYPGVFEGKEFDPEAPFTRNDTQKLRGVSNRKPDL
HGTEVRILFDPAIAPDSTLDIGEVLLRAHAAARMSPGVHLVVVDEGWPGEEVPPAVLEPF
SGPWGTDTLLDLMCTAAGTPLPEVRAVVEGRGEYTTGRGPTPFRWSLTAGPAEPATVAAF
CNTVRTPGGGSHLTAAIKGLSEALAERASRMRDLGLAKNEEGPEPQDFAAVTALAVDTRA
PDVAWDSQAKTAVSSRSLNLAMAPDVARSVTIWAANPANADTVTLWSKLALESARARRSA
EGAKARARAASKAKGLGTNLSLPPKLLPSRESGRGSGAELFLCEGDSALGTIKAARDATF
QAAFPLKGKPPNVYGFPLNKARAKDEFDAIERILGCGVRDHCDPELCRYDRILFASDADP
DGGNINSSLISMFLDFYRPLVEAGMVYVTMPPLFVVKAGDERIYCQDESERDAAVAQLKA
SSNRRVEVQRNKGLGEMDADDFWNTVLDPQRRTVIRVRPDESEKKLHHTLFGGPPEGRRT
WMADVAARVDTSALDLT
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
gtgagttacaccgccgcagacatcaccgagctcgacgatgtccagcacacgcggctgcgg
ccggcggtgaacctgggcctcgacgtgctcaacaccgccctgcgcgagatcgtcgacaac
gcgatcgaggaggtcgccgatcccggccacggcgggtcgaccgtcacgatcaccctgcac
gccgacggttcggtcagcgtcgccgacgacggccgcggcctgcccgtcgacaccgacccg
accaccgggaagaacggcatcgtcaagacgctgggcacagcccgcgccggcggcaagttc
tccgcgcacaaggacgccaccagcaccggcgccggcctcaacggcatcggcgcggcggcc
gcggtgttcatctccgcgcgcaccgacgtcacggtgcgccgtgacggcaagacctttctg
cagagcttcggccgcggttatccgggcgtgttcgagggcaaggagttcgacccggaggcc
ccgttcacccgcaacgacacccagaaactgcgcggcgtcagcaaccgcaagcccgacctg
cacggcaccgaggtgcgcatcctgttcgaccctgcgatcgcgccggactcgaccctggac
atcggcgaggtgctgctgcgcgcacacgccgcggcgcggatgtcgcccggcgtgcacctg
gtcgtcgtcgacgagggctggcccggcgaagaggtcccgccggcggtgctcgaaccgttc
agcgggccgtggggcaccgacaccctgctcgacctcatgtgcaccgcggcgggcactccc
ctgcccgaggtccgcgccgtcgtggaaggccgcggcgagtacaccacgggccgcggaccg
accccgttccgctggtcgctgacggccggaccggccgaaccggcgacggtcgccgcgttc
tgcaacaccgtgcgcacacccggcggcggatcgcacctgaccgccgcgatcaagggtctg
tccgaggcgttggccgagcgcgcgtcccgcatgcgcgatctgggcctggccaagaacgaa
gaaggcccggaaccacaggatttcgcggccgtgaccgcactggccgtggacacccgcgca
ccggacgtcgcgtgggattcgcaggccaagaccgcggtgtcgtcgcgctcgctgaacctg
gcgatggccccggatgtggcgcgcagcgtgacgatctgggcggccaaccccgccaacgcc
gacaccgtgacgctgtggagcaagctggcactggagtccgcgcgcgcccgccgcagcgcc
gagggcgccaaggcccgcgcccgtgcggcatcgaaggccaaaggtctcggtaccaacctg
tcgctgccgcccaagctgctgcccagccgcgagtcgggccgtggttcgggcgccgaactg
ttcctctgcgagggcgattcggctctgggcaccatcaaggccgcgcgcgacgcgacgttc
caggccgcgttcccgctgaaaggcaagccgcccaacgtctacggtttcccgttgaacaag
gcgcgggccaaagacgagttcgacgcgatcgagcgcatcctgggctgcggcgtgcgcgac
cactgcgacccggaactgtgccggtacgaccggatcctgttcgcctccgacgccgacccc
gacggtggcaacatcaactcgagcctgatctcgatgttcctggacttctaccgtccgctc
gtcgaagccgggatggtgtacgtgaccatgccgccgctgttcgtggtgaaggcaggcgac
gagcggatctactgccaggacgagtccgaacgcgacgcggccgtggcccagttgaaggcg
tcctccaaccgacgcgtggaggtacagcgcaacaagggtctcggtgagatggacgccgac
gacttctggaacaccgtgctggatccgcagcgccgcacggtgattcgggtacgccccgac
gagagcgagaagaagctgcaccacacgttgttcggcggaccgccggagggccggcgcacg
tggatggccgatgtcgccgcccgcgtcgacacctccgcgctggacctgacgtag

DBGET integrated database retrieval system