KEGG   Mycolicibacterium smegmatis MC2 155: MSMEI_0770Help
Entry
MSMEI_0770        CDS       T02191                                 

Gene name
pknG
Definition
(GenBank) putative serine/threonine-protein kinase pknG
  KO
K14949  serine/threonine-protein kinase PknG [EC:2.7.11.1]
Organism
msg  Mycolicibacterium smegmatis MC2 155
Brite
KEGG Orthology (KO) [BR:msg00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:msg01001]
    MSMEI_0770 (pknG)
Enzymes [BR:msg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     MSMEI_0770 (pknG)
Protein kinases [BR:msg01001]
 Serine/threonine kinases: Other
  Bacterial family
   MSMEI_0770 (pknG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PknG_TPR PknG_rubred Pkinase Pkinase_Tyr TPR_19 Nudix_N_2 DZR RIO1 zf-ribbon_3
Motif
Other DBs
NCBI-ProteinID: AFP37250
UniProt: A0QQK3
LinkDB All DBs
Position
complement(873630..875912)
Genome map
AA seq 760 aa AA seqDB search
MTSPENPDLPDADDAYVDSGPGTQPASLEDLDMDSASTMRPMATQAVYRPEFDDTDGTSR
GTVVTEAYDQVTMATRALSPMRRLGGGLVEIPRVPERDPLTALMTNPVVAESKRFCWNCG
KPVGRSTPDGRALSEGWCPHCGSPYSFLPQLSPGDIVADQYEIKGCIAHGGLGWVYLAFD
KNVNDRPVVLKGLVHSGDAEAQAIAMAERQFLAEVTHPGIVKIYNFVEHEDKHGNPVGYI
VMEYVGGTSLKQARGAKLPVAEAIGYMLEILPALGYLHSIGLAYNDLKPENIMITEEQLK
LIDLGAVSRLNSYGYLYGTPGYQAPEIVRTGPTVATDIYTVGRTLAALTLSLRTRRGRYV
DGLPSDDPVLETYDSYHRLLRRAIDPDPRRRFTSAEEMSSQLLGVLREVVATDTGVPRPG
LSTVFSPSRSTFGVDLLVAHTDVYVDGQVHSEKLTAQEIVRALPVPLVDRTDVGAPMLVA
SVLSEPVHTLDQLRAARHGALDTEGIDLNESVELPLMEVRALLDLGDVAKATRKLEDLAA
RVGWRWRLVWFKAVSEMLSADYDSATKHFTEVLDTLPGELAPKLALAATAELAGTADELK
FYKTVWSTDNGVISAGFGLARAQSVAGERDMAVQTLDEVPPTSRHFTTARLTSAVTLLSG
RSTSEITEQHIRDAARRVEALPDSEPRVLQIRALVLGTALDWLADNTASSNHILGFPFTE
HGLKLGVEASLRALARIAPTQSHRYALVDLANSVRPMSTF
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atgacttcacccgagaaccctgatctcccagacgccgacgacgcttacgtcgacagcggg
ccgggcacacaaccggcgagcctggaagacctcgacatggactcggcgtcgaccatgcgg
cccatggcgacgcaggccgtgtaccggcccgagttcgacgacaccgacggcacatcgcgc
ggcacggtggtcaccgaggcctacgaccaggtcaccatggccacgcgcgcgttgtccccg
atgcggcgcctcggcggcgggctggtggagatcccgcgtgtccccgaacgcgacccgctc
accgcgttgatgaccaatccggttgtggccgagtcgaaacggttctgctggaactgcggc
aagcccgtcggacggtcgacgccagacggccgcgccctgtccgagggctggtgcccgcac
tgcggcagcccgtattcgttcctgccgcaactgtccccgggcgacatcgtggccgaccag
tacgagatcaagggttgcatcgcgcacggcggcctgggctgggtgtacctggcgttcgac
aagaacgtcaacgaccgcccggtggtgctcaagggtctggtgcattccggtgacgccgag
gcgcaggccatcgccatggccgaacggcagttcctcgccgaggtgacgcacccgggaatc
gtcaagatctacaacttcgtcgagcacgaggacaagcacggcaaccccgtcggctacatc
gtgatggagtacgtcggcggcacgtcgctcaaacaagccaggggcgccaagctcccggtg
gccgaggcgatcggctacatgctcgagatcctgcctgcgctgggctatctgcattcgatc
ggcctggcctacaacgacctcaagcccgagaacatcatgatcaccgaggaacagctcaag
ctgatcgacctcggtgcggtgtcgcgcctgaactcctacggatacctctacggcacaccg
ggttaccaggctcccgagatcgtgcgcaccggcccgacggtggccaccgacatctacacc
gtgggccgcacactggccgccttgacgctgtcgctgcggacccgacgtggacgctacgtc
gacggcctgccgtccgacgatcctgtgctggagacctacgactcgtaccaccggttgctg
cgtcgcgcgatcgacccggatccgcggcgacgcttcaccagcgccgaggagatgtcgtcg
cagcttctcggtgtgctgcgcgaggtggtcgcgaccgacaccggggttccgcggcccggc
ctgtcgacggtgttcagcccatcacgctcgacgttcggagtggacctgctggtggcgcac
accgacgtttacgttgacgggcaggtgcactcggagaagctgaccgcgcaggagatcgtg
cgggcgctgccggtgccgctggtcgaccgcaccgacgtcggcgcgccgatgctggtggcc
agcgtgctcagcgagcccgtccacacgctggaccagctgcgtgcggcgcgtcacggtgcg
ctcgacaccgagggcatcgacctcaacgagtcggtcgagcttccgctcatggaggtccgg
gcgctgctcgatctcggtgatgtcgccaaggccacccgcaagctcgaggatctcgcggcg
cgcgtcggttggcgctggcggctggtctggttcaaggccgtctccgagatgctctcggcc
gattacgattcggcgacaaagcatttcaccgaagtgctggacacgctgcccggtgagctg
gcgcccaagctcgcactcgccgcgaccgcggagttggcgggcacggccgacgagttgaag
ttctacaagaccgtgtggagcaccgacaacggcgtgatctccgccgggttcggcctggcc
cgcgcgcaatcggtcgccggtgaacgcgatatggccgtgcagacgctcgacgaagttccg
cccacctcaaggcatttcaccactgcccggctcaccagcgcggtgacactgctgtcgggc
cggtcgaccagtgagatcaccgagcagcacatccgcgacgccgcacgccgcgtcgaggcc
ctgccagactccgaaccccgcgtgttgcagatccgcgcgctggtgctgggaaccgcgctc
gactggctcgccgacaacaccgcgagcagcaaccacattctgggattcccgttcaccgag
cacggtctcaagctcggcgtcgaggcatcgctgcgcgcactggcccgcatcgctcccacg
cagtcgcaccgctacgccctggtcgacctggccaacagcgtgcggccgatgagcacgttc
tag

DBGET integrated database retrieval system