KEGG   Mycolicibacterium smegmatis MC2 155: MSMEI_1536Help
Entry
MSMEI_1536        CDS       T02191                                 

Gene name
gadB
Definition
(GenBank) Glutamate decarboxylase gadB
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
msg  Mycolicibacterium smegmatis MC2 155
Pathway
msg00410  beta-Alanine metabolism
msg00430  Taurine and hypotaurine metabolism
msg00650  Butanoate metabolism
msg01100  Metabolic pathways
msg01110  Biosynthesis of secondary metabolites
msg01120  Microbial metabolism in diverse environments
msg02024  Quorum sensing
Module
msg_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:msg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    MSMEI_1536 (gadB)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MSMEI_1536 (gadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MSMEI_1536 (gadB)
   00430 Taurine and hypotaurine metabolism
    MSMEI_1536 (gadB)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    MSMEI_1536 (gadB)
Enzymes [BR:msg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     MSMEI_1536 (gadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AFP38009
UniProt: I7G5Y1
LinkDB All DBs
Position
1665863..1667266
Genome map
AA seq 467 aa AA seqDB search
MSTSKGNFMSHKQSRGPHVAPAYTGRLAMAPVPSLRLPDEAMDPSAAYRFIHDELMLDGS
SRLNLATFVTTWMDPEAEKLMAETFDKNMIDKDEYPATAAIEARCVSMVADLFHAEDLRD
DDPASAVGVSTIGSSEAVMLAGLAMKWRWRAKAGDWKGRTPNLVMGANVQVVWEKFCRYF
DVEPRYLPMAEGRYVITPEQVLDAVDEDTIGVVAILGTTYTGELEPVAEICEALDKLAAG
GGVDVPVHVDAASGGFVVPFIHPDLVWDFRLPRVVSINVSGHKYGLTYPGVGFVVWRNKE
HLPEELVFRVNYLGGDMPTFTLNFSRPGNQVVGQYYNFLRLGRAGYTQVMQCLSQTARWL
GDELRDSEHFELISDGSAIPVVAFRLKGDPGYTEFDISQALRAHGWQVPAYTMPEGAEDV
VVLRVVVREGFSADLARALKDDIITVLGQLDALKPRGQFDQLQPFAH
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
gtgagcacctcgaaaggaaacttcatgtcgcacaagcagagtcgcggtccgcacgtcgcg
ccggcgtacaccggacggttggccatggcgcccgtgccgtcgctgcgcctgcccgacgag
gccatggatccgtctgcggcgtaccggttcatccacgacgagttgatgctcgacggcagc
tcgcggctgaacctcgcgacgttcgtgacgacgtggatggaccccgaggccgagaagctc
atggccgagacgttcgacaagaacatgatcgacaaggacgagtacccggccaccgcggcc
atcgaggcccgctgcgtgtcgatggtggccgacctgttccacgccgaggatctgcgcgac
gacgacccggcgagcgccgtcggggtgtcgacgatcgggtccagcgaggccgtgatgctg
gccgggctggcgatgaaatggcgctggcgcgccaaggccggcgactggaaggggcgcacg
ccgaacctggtgatgggcgccaacgtccaggtggtgtgggagaagttctgccgctacttc
gacgtcgaaccccgctacctgccgatggcagagggccgctacgtcatcacgcccgagcag
gttctcgacgccgtcgacgaggacaccatcggcgtcgtggcgatcctgggcaccacctac
accggcgagctggaaccggtcgccgagatctgcgaggcgctggacaagctcgccgcgggc
ggcggggtggacgtgccggtgcacgtcgacgcggccagcggcgggttcgtggtgccgttc
atccatcccgacctggtgtgggacttccggctgccccgcgtggtgtcgatcaacgtcagc
ggccacaagtacggcctgacgtacccgggtgtcgggttcgtggtgtggcgcaacaaagag
cacctgcccgaggagctggtgttccgggtcaactacctcggcggcgacatgccgacgttc
acgctgaacttctcgcggcccggcaaccaggtggtggggcagtactacaacttcctgcgg
ctggggcgcgccgggtacacccaggtgatgcagtgcctgtcgcagaccgcccggtggctg
ggcgacgagctgcgcgacagcgagcacttcgagctgatctccgacggttcggccatcccg
gtcgtggcgttccgtctcaagggcgatcccggatacaccgagttcgacatctcgcaggca
ctgcgggcgcacggctggcaggtgcccgcgtacaccatgcccgagggcgccgaagacgtc
gtggtgctgcgtgtggtggtccgtgaggggttctccgccgacctcgcgcgggcgctcaag
gacgacatcatcacggtgctgggccagctcgacgcgctcaaaccgcgcgggcagttcgac
cagctccagcctttcgcgcattag

DBGET integrated database retrieval system