KEGG   Mycolicibacterium smegmatis MC2 155: MSMEI_6138Help
Entry
MSMEI_6138        CDS       T02191                                 

Definition
(GenBank) ATP dependent DNA ligase
Organism
msg  Mycolicibacterium smegmatis MC2 155
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: AFP42568
UniProt: A0R5T3
LinkDB All DBs
Position
6371001..6372065
Genome map
AA seq 354 aa AA seqDB search
MDLPVLPPVSPMLSKSVNQIPPGMSYEPKWDGFRSILFRDGAEVELGSRKERPMTRYFPE
LVAAALTELPDRCVIDGEIVLPADNHLDFEALQLRLHPAASRVAMLAEQTPAAFIAFDLL
ALGDDDYTGRPFSERRAALETALADAGPTFHLTPATTDLPTAQRWFHEFEGAGLDGVIAK
PLDLTYQPDKRVMFKVKHQRTADCVVAGYRLHKSGADAVGSLLLGLYDDDGSLASVGVIG
AFPMATRRALFTELQTLVADFDHHPWNWAAQAAADPELARRYGGGSRWNAGKDLSFVPLR
PERLVEVRYDHMEGRRFRHTAQFNRWRPDRDARSCTFAQLDSPPHSSSVTSCRV
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggacctgcccgtgctgcctccggtgtcgcccatgctgtcgaagtccgtgaaccagatc
ccgccggggatgtcgtatgaacccaagtgggacgggttccggtcgatcctgttccgcgac
ggcgccgaggtggaactcggcagccgcaaggaacggcccatgacccgctactttcctgaa
ttggtggccgcggcgctgaccgagcttcccgaccgctgcgtgatcgacggcgagatcgtc
ctaccggccgacaaccacctcgacttcgaggcgctgcaactgcgtctgcaccccgccgcg
agccgggtggcgatgctcgccgaacagacgcccgcagcgttcatcgcgttcgatctgctg
gcactcggcgacgacgactacaccggccgaccgttcagcgagcgtcgcgccgcgctcgag
accgccctcgcggatgccggcccgacgttccacctgacgcccgccaccaccgatctgccg
actgcgcagcgctggttccacgagttcgaaggcgccggtctcgacggggtcatcgccaaa
cccctggacctgacctaccagccggacaagcgcgtcatgttcaaggtcaagcaccagcgc
accgcggactgcgtggtcgccgggtaccggctgcacaaatccggcgccgacgccgtgggc
tcgctgctgctcgggttgtacgacgacgacggcagcctcgcgtcggtcggcgtcatcggc
gccttcccgatggcgacccggcgggcgctgttcaccgaactgcagacgctggtagccgat
ttcgaccatcacccgtggaactgggccgcgcaggccgcggccgatccggaactcgcccga
cgctacggcggcgggtcacgctggaatgcgggcaaggatctgtcgttcgtcccgcttcgc
cccgaacgcctggtcgaggtgcgctacgaccacatggagggccgccggttccggcacacc
gcgcagttcaaccgctggcgcccggaccgcgacgcgcgttcgtgcacattcgcacagctc
gactccccaccgcattcgagctcggtgacatcgtgccgggtttag

DBGET integrated database retrieval system