KEGG   Mycolicibacterium smegmatis MC2 155: MSMEI_6260Help
Entry
MSMEI_6260        CDS       T02191                                 

Gene name
sodB
Definition
(GenBank) Superoxide dismutase Fe
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
msg  Mycolicibacterium smegmatis MC2 155
Brite
Enzymes [BR:msg01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     MSMEI_6260 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AFP42686
UniProt: A0R652
LinkDB All DBs
Position
6497940..6498563
Genome map
AA seq 207 aa AA seqDB search
MAEYTLPDLDYDYGALEPHISGQINELHHSKHHATYVKGVNDAIAKLEEARANGDHAAIF
LNEKNLAFHLGGHINHSIWWKNLSPNGGDKPTGELAAAIDDQFGSFDKFQAQFTAAANGL
QGSGWAVLGYDSLGGRLLTFQLYDQQANVPLGIIPLLQVDMWEHAFYLQYKNVKADYVKA
FWNVVNWDDVQNRFAAATSKTSGLIFG
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
gtggctgaatacaccctgccggacctggattacgactatggagccctcgagccccatatc
tccggtcagatcaacgagctgcaccacagcaagcaccacgcgacctacgtcaagggtgtg
aacgacgcgattgccaagctcgaggaggcacgggccaacggtgaccacgcggccatcttc
ctgaacgagaagaacctcgcgttccatctcggtggccacatcaaccactcgatctggtgg
aagaacctctcccccaacggtggcgacaagcccaccggcgagctcgcggccgcgatcgac
gaccagttcggctcgttcgacaagttccaggcacagttcaccgctgcggccaacggcctg
cagggttcgggctgggcagtgctcggatacgacagcctcggtggccgtctgctgaccttc
cagctctacgaccagcaggccaacgtgccgctcggcatcatcccgctgctccaggtcgac
atgtgggagcacgcgttctacctgcagtacaagaacgtcaaggccgactacgtcaaggcc
ttctggaacgtcgtcaactgggatgacgtgcagaaccgcttcgcggcagccacttccaag
accagcggtctgatcttcggctga

DBGET integrated database retrieval system