KEGG   Mycolicibacterium smegmatis MC2 155: MSMEI_6578Help
Entry
MSMEI_6578        CDS       T02191                                 

Gene name
glpD2
Definition
(GenBank) Glycerol-3-phosphate dehydrogenase GlpD2
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
msg  Mycolicibacterium smegmatis MC2 155
Pathway
msg00564  Glycerophospholipid metabolism
msg01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:msg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    MSMEI_6578 (glpD2)
Enzymes [BR:msg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     MSMEI_6578 (glpD2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 FAD_oxidored FAD_binding_2 Pyr_redox_2 NAD_binding_8 GIDA Pyr_redox 3HCDH_N AlaDh_PNT_C Thi4 HI0933_like
Motif
Other DBs
NCBI-ProteinID: AFP43004
UniProt: I7GGN8
LinkDB All DBs
Position
6806891..6808591
Genome map
AA seq 566 aa AA seqDB search
MGAYPLSPAHRAAALDRLASDEFDVLVVGGGVVGAGAALDAATRGLRVGLVEARDYASGT
SSRSSKLFHGGLRYLEQFNFSLVFEALRERSLVLNTLCPHLARPVPFIYPLQTRFDRAYA
GLGIGVYDVMGAGRGVPGHHEHLGRARTLESFPSGSPAIRGAIRFYEGQVDDARHTMMLV
RTAAHFGAVCANSTRVTGFVRDGERVAGVGVRDLDGGREFEVRAKQVINATGVWTDETQG
MAGGQGQFRVRASKGVHLVVPRSRINSSTGIITRTEKSLLFVIPWGSHWIVGTTDTDWSL
DLAHPAASRADIEYLLGHVNTLLADPLTADDVVGVYAGLRPLLAGESDSTSKLSREHAVA
SPVPGLTVIAGGKYTTYRVMAKDAVDLAVRGLGRAVPSSCTERVPLLGADGYPAAWNARR
RTAEDTGLAVTTVAHLLGRYGTLTDELLEIIAHRPDLGVPLAGAPEYLKVEAYYAASHEG
ARHLEDVLTRRTRISIEVADRGVAAAREVADLIAPVLGWSQTDIAREIEHYDARVAAERE
SQHQLDDYTADAARLGAPDVRVGVTQ
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
gtgggtgcttatccgctgagtccggctcatcgcgccgcggcactcgaccggctcgcgagt
gacgagttcgacgtcctcgtcgtcggtggcggcgtggtgggcgcgggcgccgcgctcgac
gcggccacgcgcgggctgcgggtcggactggtcgaggcacgtgactacgcgtcgggcacg
tcgagccggtcgagcaagctcttccacggcgggctgcgctatctcgagcagttcaacttc
tcgctggtgttcgaggcactgcgtgaacgctcgctggtgctcaacacgctgtgcccgcac
ctggcccggcccgtgccgttcatctacccgctgcagacgcgattcgaccgcgcctacgcg
ggtctgggtatcggtgtctacgacgtcatgggcgcgggacgcggtgtgcccggccaccac
gaacatctgggccgtgcaaggacactcgaatcgttcccctcgggcagtccggcgatccgc
ggcgcgatccggttctacgaggggcaggtggacgacgcccgccacaccatgatgctcgtg
cgcacggccgcacacttcggcgcggtgtgcgcgaacagcacccgggtgacgggtttcgta
cgcgacggcgagcgcgtggccggcgtcggggtgcgtgatctggacggcggacgtgagttc
gaggtccgcgcaaagcaggtcatcaacgcgaccggggtgtggacggacgagactcagggc
atggccggtggtcagggccagttccgcgtgcgggcgtccaaaggggtgcacctcgtggtg
ccccgcagccggatcaactcgtcgaccggcatcatcacgcgcaccgagaagagcctgctg
ttcgtgatcccgtggggcagccactggatcgtcgggaccaccgacaccgactggtcactc
gacctggcgcaccccgcggcgagccgcgccgacatcgagtacctgctcgggcacgtcaac
acgctgctcgccgatccgctcaccgcggacgacgtggtcggcgtgtacgcggggctgcgc
ccgctgctggccggggagtccgactccacgagcaagctctcgcgcgaacatgcggtcgcc
tcccctgttcccggcctcacggtcatcgcaggcggcaagtacaccacctaccgcgtgatg
gcaaaggatgccgtggatctcgcggtcaggggtctcggtcgtgccgtgccgtcctcgtgc
accgagcgcgtgccactgctcggcgcggacggttacccggccgcgtggaacgcgcgccgt
cgcaccgccgaggacaccggtctggcggtgacgacggtcgcgcatctgctggggcgttac
ggcaccctgaccgacgagttgctcgaaatcatcgcgcatcgacccgatctcggtgttccc
ttggcgggcgctccggagtatctcaaggtggaggcgtactacgcggcgagccacgagggg
gcgcggcacctggaggacgtgctgacccgccgtacccggatctcgatcgaggtggccgac
cgcggagtcgccgccgcgcgggaggtcgccgacctgatcgcaccggtgctcgggtggagt
cagaccgacatcgcccgggagatcgagcattacgacgcccgcgtggccgccgagcgggaa
tcccagcaccagctcgatgattacaccgcggacgccgcacgcctcggcgcgcccgacgtg
cgggtgggcgtcacgcagtga

DBGET integrated database retrieval system