KEGG   Mycolicibacterium smegmatis INHR2: LI98_02075Help
Entry
LI98_02075        CDS       T03432                                 

Definition
(GenBank) fumarate reductase
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
msh  Mycolicibacterium smegmatis INHR2
Pathway
msh00020  Citrate cycle (TCA cycle)
msh00190  Oxidative phosphorylation
msh00650  Butanoate metabolism
msh01100  Metabolic pathways
msh01110  Biosynthesis of secondary metabolites
msh01120  Microbial metabolism in diverse environments
msh01130  Biosynthesis of antibiotics
msh01200  Carbon metabolism
Module
msh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
msh_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
msh_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:msh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LI98_02075
   00650 Butanoate metabolism
    LI98_02075
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    LI98_02075
Enzymes [BR:msh01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     LI98_02075
    1.3.5.4  fumarate reductase (quinol)
     LI98_02075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer2 Fer4_17 Fer4_18 Fer4_9 Fer4_7 Fer4_16
Motif
Other DBs
NCBI-ProteinID: AIU18940
UniProt: A0A0D6G6K3
LinkDB All DBs
Position
complement(492843..493592)
Genome map
AA seq 249 aa AA seqDB search
MATYDAKLRVWRGDDTGGELHDYTVEVNDGEVVLDIIHRLQATQTPDLAVRWNCKAGKCG
SCSAEINGRPRLMCMTRMSTFGEDEVVTVTPLRTFPVMRDLVTDVSFNYEKARQIPSFTP
PKDLQPGEYRMQQEDVNRSQEFRKCIECFLCQNVCHVVRDHEENKENFAGPRFHMRIAEL
DMHPLDTVDRKEMAQDEFGLGYCNITKCCTEVCPEHIKITDNALIPMKERVADRKYDPIV
WLGNKLFRR
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggctacttacgacgcgaaactgcgggtgtggcgcggcgacgacaccggcggcgaactg
cacgactacaccgtcgaggtcaacgacggcgaggtggtcctcgacatcatccaccgcctg
caggccacccagacaccggatctcgcggtgcggtggaactgcaaggcaggcaagtgcggt
tcgtgctcggcggagatcaacggcaggccgcggctgatgtgcatgacgcgcatgtccacc
ttcggcgaggacgaggtcgtcacggtcacgccactgcgcacgttcccggtgatgcgtgac
ctcgtgaccgacgtgtcgttcaactacgagaaggcacggcagatcccgtcgttcacaccg
ccgaaggatctgcagcccggtgagtaccgaatgcagcaggaggacgtgaaccggtcacag
gagttccgcaagtgcatcgagtgcttcctgtgccagaacgtgtgccatgtggtgcgtgat
cacgaagagaacaaggagaacttcgccggaccgcggttccacatgcgcatcgccgagctg
gacatgcatccgctcgacaccgtcgaccgcaaggagatggcacaggacgagttcgggctc
ggctactgcaacatcacgaagtgctgcaccgaggtgtgtcccgagcacatcaagatcacc
gacaatgcgttgatccccatgaaagagcgcgtcgcggaccgcaagtacgacccgattgtc
tggttgggcaacaagctgttccggcggtga

DBGET integrated database retrieval system