KEGG   Mycolicibacterium smegmatis INHR2: LI98_02080Help
Entry
LI98_02080        CDS       T03432                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
msh  Mycolicibacterium smegmatis INHR2
Pathway
msh00020  Citrate cycle (TCA cycle)
msh00190  Oxidative phosphorylation
msh00650  Butanoate metabolism
msh01100  Metabolic pathways
msh01110  Biosynthesis of secondary metabolites
msh01120  Microbial metabolism in diverse environments
msh01130  Biosynthesis of antibiotics
msh01200  Carbon metabolism
Module
msh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
msh_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
msh_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:msh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LI98_02080 (sdhA)
   00650 Butanoate metabolism
    LI98_02080 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    LI98_02080 (sdhA)
Enzymes [BR:msh01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     LI98_02080 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     LI98_02080 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO HI0933_like Thi4 GIDA Pyr_redox_3 FAD_binding_3 Lycopene_cycl FAD_oxidored AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AIU18941
UniProt: A0A0D6G5S3
LinkDB All DBs
Position
complement(493594..495501)
Genome map
AA seq 635 aa AA seqDB search
MSELERHSYDVVVIGAGGAGLRAVIEARERGLRVAVVTKSLFGKAHTVMAEGGCAAAMRN
VNTKDSWQVHFGDTMRGGKFLNNWRMAELHAQEAPDRVWELETYGALFDRTKDGKISQRN
FGGHTYPRLAHVGDRTGLEIIRTLQQKIVSLQQEDKRELGDYEARIRVFHETSITELILD
DGKIAGAFGYYRETGNFVLFEAPAVVLATGGIGKSFKVSSNSWEYTGDGHALALRAGSAL
INMEFIQFHPTGMVWPLSVKGILVTEGVRGDGGVLKNSEGKRFMFDYIPSVFKGQYAETE
EEADQWLKDNDSARRTPDLLPRDEVARAINAEVKAGRGSPHGGVYLDIASRMPAEEIKRR
LPSMYHQFIELAEVDITKDAMEVGPTCHYVMGGIEVDPDTAAGATPGLFAAGECSGGMHG
SNRLGGNSLSDLLVFGRRAGLGAADYVRALPDRPKVSEAAVEDATRLVLAPFEPKAEPEN
PYTLHAELQQSMNDLVGIIRKEAEIQEALDRLQELKRRYANVTVEGGRVFNPGWHLAIDM
RNMLLVSECVAKAALQRTESRGGHTRDDYPEMDANWRNTLLVCRVSGGDPVVPDVTVTPE
QQVPMRPDLLGCFELSELEKYYTPEELAEHPERKG
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaactggagcggcactcctacgacgtcgtcgtgatcggtgccggcggggcggga
ctgcgcgccgtgatcgaggcacgcgaacgcggtctgcgcgtcgctgtggtgacgaaatcg
cttttcggcaaggcccataccgtgatggccgagggcggctgcgccgcggcgatgcgcaac
gtcaacaccaaggactcctggcaggtgcacttcggtgacaccatgcgcggtggcaaattc
ctcaacaactggcggatggccgaactgcacgcgcaggaggcgcccgaccgcgtgtgggaa
ctggagacctacggcgcgctgttcgaccgcaccaaggacggcaagatcagccagcgcaac
ttcggcggccacacctacccgcgcctggcgcacgtcggcgaccgcaccggcctggagatc
atccgcaccctgcagcagaagatcgtgtcgctgcagcaggaggacaaacgtgaactcggc
gactacgaggcccgcatccgggtgttccacgagacctcgatcaccgaactgatcctggac
gacggcaagatcgccggcgcgttcggctactaccgcgagaccggcaacttcgtgctgttc
gaggcgcccgcggtggtgctcgccacgggcggcatcggcaagtcgttcaaggtgtcgtcg
aactcatgggagtacaccggcgacggccacgcgctggcactgcgcgccggttcggccctg
atcaacatggagttcatccagttccacccgaccggcatggtctggccgctgtcggtgaag
ggcatcctggtcaccgaaggcgtgcgcggcgacggcggggtgctgaagaactccgagggc
aagcggttcatgttcgactacatcccctcggtgttcaaaggccagtacgccgagaccgag
gaagaagccgaccagtggctcaaggacaacgactcggcacgccgcacccctgacctgctt
ccccgcgacgaggtggcccgcgccatcaacgccgaggtgaaggccggccgcggctcgccg
cacgggggcgtgtacctcgacatcgcgtcacgcatgcccgccgaggagatcaagcgcagg
ctgccgtcgatgtaccaccagttcatcgagctcgccgaggtggacatcaccaaggacgcc
atggaggtcggccccacctgccactacgtcatgggtggtatcgaggtcgatccggacact
gctgcgggcgcgaccccaggcctgttcgccgcgggcgagtgctcgggtggcatgcacggt
tcgaaccggctcggcggcaactcgctgtcagatctgttggtgttcggccgccgcgccggt
ctgggcgccgccgactacgtgcgggcccttccggaccggccgaaggtttccgaagccgcg
gtcgaagacgcgacccggctcgtcctggcgccgttcgagcccaaggccgaacccgagaat
ccctacacgctgcacgccgaactgcagcagtcgatgaacgacctggtgggcatcatccgc
aaggaggccgagatccaggaggcgctcgacaggctgcaggaactcaagcggcgctacgcc
aatgtgaccgtcgaaggcgggcgcgtgttcaaccccggttggcacctggccatcgacatg
cgcaacatgctgctggtcagcgaatgcgtcgcgaaagccgcgctgcagcgcaccgagagc
cgcggcgggcacacacgcgacgactacccggagatggatgccaactggcgcaacacgctg
ctggtctgccgcgtctcaggtggtgacccggtggttcccgacgtgacggtgacacccgag
cagcaggtgccgatgcgacccgatctgctggggtgcttcgagctctcggagctcgaaaag
tactacaccccagaagaactggccgagcatccggaacggaagggctga

DBGET integrated database retrieval system