KEGG   Mycolicibacterium smegmatis INHR2: LI98_03425Help
Entry
LI98_03425        CDS       T03432                                 

Definition
(GenBank) Fe-S oxidoreductase
Organism
msh  Mycolicibacterium smegmatis INHR2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CCG Fer4_8 Fer4_7 Fer4_9 Fer4_10 Fer4_17 Fer4_2 Fer4 Fer4_16 Fer4_4 Fer4_3 Fer4_21 Fer4_6 Fer4_22
Motif
Other DBs
NCBI-ProteinID: AIU19203
LinkDB All DBs
Position
complement(773441..776569)
Genome map
AA seq 1042 aa AA seqDB search
MAHTLEVSRLIIGLLMTAIVLVFAAKRVLWLTKLIRSGQKTLDENGRKNDLQKRITTQIT
EVFGQTRLLRWSVPGIAHFFTMWGFFVLASVYLEAYGVLFDPEFHIPFIGRWPVLGFLQD
FFAVAVLLGIIVFAIIRVVREPKKIGRDSRFYGSHTGGAWEILFMIFLVIATYALFRGAA
VNTLGERFPYQSGAFFSDFMAWILRPLGATANMWIETVALMGHIGVMLVFLLIVLHSKHL
HIGLAPINVTFKRLPNGLGPLLPMESNGEYIDFEDPAEDAVFGKGKIEDFTWKGYLDFTT
CTECGRCQSQCPAWNTGKPLSPKLVIMNLRDHMFAKAPYILGEKPSPLESTPEGGLGEKA
RGEKHEQKHAHDHVPESGFERILGSGPEQALRPLVGTEEQGGVIDPDVLWSCTNCGACVE
QCPVDIEHIDHIVDMRRYQVMVESEFPGELGVLFKNLETKGNPWGQNAKDRTNWIDEVDF
DVPVYGEDVDSFDGFEYLFWVGCAGAYEDRAKKTTKAVAELLATAGVKFLVLGTGETCTG
DSARRSGNEFLFQQLAAQNVETINELFEGVETVDRKIVVTCPHCFNTIGREYPQLGANYS
VVHHTQLLNRLVRDKKLVPVKSVSEQNGQPVTYHDPCFLGRHNKVYEAPRELVEASGVTL
KEMPRHADRGLCCGAGGARMWMEEHIGKRVNVERTEEAMDTASTIATGCPFCRVMITDGV
DDVAASRNVEKAEVLDVAQLLLNSLDTSKVTLPEKGTAAKESEKRAAARAEAEAKAEAAA
PPVEEAAPEAEAPAAPAAGGAEAKPVTGLGMAGAAKRPGAKKAAPAAEASAAPAAAPAPA
KGLGLAGGAKRPGAKKAAAPAAEAPAAPASDAPPVKGLGLAGGAKRPGAKKTAAAAPAEK
PAATEAPEASATPAAPAAPVKGLGLAAGAKRPGAKKTAAAPAEKPAAAETEAPAPAETAA
PAEPAKPEPPVVGLGIAAGARRPGAKKAAAKPAAAPAPAAEKPAEQAAEPEKPAEKPAEP
EKPEPPVVGLGIKPGAKRPGKR
NT seq 3129 nt NT seq  +upstreamnt  +downstreamnt
gtggcacacaccctcgaagtgagcaggctcatcatcgggctgctcatgacggccatcgtc
ttggtgttcgccgccaagcgagtgctctggctgacgaagctgattcgctcgggccagaag
acgctcgacgagaacggccgcaagaacgatctgcaaaagcgcatcaccacgcagatcacc
gaggtcttcgggcaaacgcgcctgctgcgctggtcggttccgggcatcgcgcacttcttc
acgatgtggggcttcttcgtcctcgcctcggtgtacctcgaggcctacggcgtgctgttc
gatcccgagttccacatcccgttcatcggccgctggccggtcctgggctttctgcaggac
ttcttcgccgtcgccgtgctgctgggcatcatcgtcttcgcgatcatccgcgtcgtccgt
gagcccaagaagatcgggcgcgactcgcgcttctacggttcgcacaccggcggcgcgtgg
gagatcctgttcatgatcttcctggtcatcgcgacctacgcgctgttccgcggtgccgcg
gtcaacaccctcggcgagcgtttcccctaccagagcggcgccttcttctccgacttcatg
gcgtggatcctgcgcccgctcggcgcgaccgccaacatgtggatcgagaccgtcgccctg
atgggccacatcggcgtcatgctggtgttcctgctgatcgtgctgcactccaagcacctg
cacatcggccttgcgcccatcaacgtcacgttcaagcgcctgcccaacggcctcggcccg
ctgctgccgatggagtccaacggcgagtacatcgacttcgaggatcccgccgaggacgcg
gtgttcggtaaaggcaagatcgaggacttcacctggaagggttacctggacttcacgacc
tgtaccgagtgtggccgctgccagtcgcagtgcccggcgtggaacaccggcaaaccgctg
tcgcccaagctcgtgatcatgaacctgcgcgaccacatgttcgccaaggctccctacatc
ctgggcgagaagccgtcgccgctggagagcacgcccgagggcggcctgggtgagaaggcc
cgcggcgagaagcacgagcagaagcacgcgcacgaccacgtccccgagtccggcttcgag
cggatcctcggcagcggccccgagcaggccctgcgcccgctggtcggcaccgaggaacag
ggcggcgtgatcgatcccgacgtgctgtggtcctgcaccaactgcggtgcgtgcgtcgag
cagtgccccgtggacatcgagcacatcgaccacatcgtcgacatgcgccgctaccaggtc
atggtcgagtcggagttccccggtgagctgggcgtgctgttcaagaacctggagaccaag
ggcaacccctggggccagaacgccaaggaccgcaccaactggatcgacgaggtcgacttc
gacgtgccggtctacggcgaggacgtcgactcgttcgacgggttcgagtacctgttctgg
gtcggctgcgccggcgcctacgaggaccgcgccaagaagaccacaaaggccgtcgccgaa
ctgctcgccaccgcgggcgtgaagttcctggtgctgggcaccggcgagacctgcacgggc
gactcggcgcgccgctcgggcaacgagttcctgttccagcagctggccgcgcagaacgtc
gagaccatcaacgaactgttcgaaggcgtcgagacggtcgaccgcaagatcgtggtgacg
tgcccgcactgcttcaacacgatcggccgtgaatacccgcagctgggtgccaactacagc
gtcgtgcaccacacgcagctgctcaaccggctggtccgcgacaagaagctggttccggtc
aagtcggtcagcgagcagaacggccagcccgtcacctaccacgacccgtgcttcctgggc
cgccacaacaaggtctacgaggccccgcgtgagctggtcgaggcctccggcgtgacgctg
aaggaaatgccgcgccacgccgaccgcggcctgtgctgtggcgccggcggtgcgcgtatg
tggatggaagagcacatcggcaagcgcgtcaacgtcgaacgcaccgaagaggccatggac
acggcctcgaccatcgcgaccggctgcccgttctgccgcgtgatgatcaccgacggtgtc
gacgacgtggcggccagccgcaacgtcgagaaggccgaggtgctcgacgtcgcccagctg
ctgctgaactcgctggacaccagcaaggtcacgctgcccgaaaagggcacggcggcaaag
gaatccgagaagcgcgccgctgcccgggcagaggccgaagcgaaggcggaagcggccgct
cccccggtcgaggaagccgcacccgaagcagaggccccggccgccccggcagccggtggg
gccgaggccaagccggtcaccggcctgggcatggcgggtgccgcgaagcgtccgggcgcc
aagaaagccgcacctgccgcggaagcgtctgcggcaccggccgccgcgcccgccccggcc
aagggtctgggcctggccggcggggccaagcgtcccggcgcgaagaaggccgccgcaccg
gccgccgaggcacccgctgctccggcttcggacgctccgccggtcaaggggctcggtctc
gcgggtggtgccaagcgacccggcgccaagaagaccgcggcagctgctccggccgaaaag
cccgcagccacagaggctccggaagcgtcggcgaccccggcagccccggcggcgcccgtg
aaggggctgggtctcgcggcaggcgccaagcgtcccggcgccaagaagaccgcagccgca
ccggccgaaaagcccgcagccgcagagaccgaggcaccggcgccggcagaaaccgcggct
ccggccgagccggccaagcccgaaccgcccgtcgtgggcctcggcatcgccgcgggcgct
cgccgtccgggtgccaagaaggcggccgccaagcctgccgctgcgccggcgcccgccgcc
gagaagccggccgagcaggccgcggagcccgaaaagcccgcggagaagccggctgagccc
gagaagccggaaccgcccgtggtggggctcggcatcaagccgggcgccaagcggcccggt
aagcgctga

DBGET integrated database retrieval system