KEGG   Mycolicibacterium smegmatis INHR2: LI98_11765Help
Entry
LI98_11765        CDS       T03432                                 

Definition
(GenBank) glutamyl-tRNA amidotransferase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
msh  Mycolicibacterium smegmatis INHR2
Pathway
msh00970  Aminoacyl-tRNA biosynthesis
msh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msh00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    LI98_11765
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:msh03029]
    LI98_11765
Enzymes [BR:msh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     LI98_11765
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     LI98_11765
Mitochondrial biogenesis [BR:msh03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    LI98_11765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase PDH
Motif
Other DBs
NCBI-ProteinID: AIU20798
UniProt: A0A0D6HSV1
LinkDB All DBs
Position
2446463..2447947
Genome map
AA seq 494 aa AA seqDB search
MSTELIRSDAATLGAKIAAKEVSSTEVTQAHLDQIAATDDRFHAFLHVAADSALAEAARV
DAAVAAGEQLPSPLAGVPLALKDVFTTTDMPTTCGSKILEGWQSPYDATVTVKLRAAGIP
ILGKTNMDEFAMGSSTENSAYGPTRNPWNTERVPGGSGGGSAAALAAYQAPLAIGSDTGG
SIRQPAALTATVGVKPTYGTVSRYGLIACASSLDQGGPCARTVLDTALLHAVIAGHDARD
STSVKADVPDVVAAARAGATGDLKGVRVGVVKQLRGDGYQPGVLQSFNAAVEQLTALGAE
VTEVDCPHFDHAMAAYYLILPSEVSSNLARFDAMRFGLRVGDDGTHSAEEVMALTRAAGF
GPEVKRRIMIGTYALSAGYYDAYYNQAQKVRTLIARDLDRAYENVDVLVSPATPTTAFGL
GEKVDDPLAMYLFDLCTLPLNLAGHCGMSVPSGLSPDDGLPVGLQIMAPALADDRLYRVG
AAYEAARGPLPSAL
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgaactgatccgcagcgacgccgcgacgctgggcgccaagatcgcggccaag
gaggtgtcctcgaccgaggtcacccaggcccacctcgaccagatcgccgcgaccgacgat
cgcttccacgcgttcctgcacgtcgctgccgattccgcactcgccgaggcggcccgcgtc
gacgccgcggtcgcggcaggcgagcagctgccgtcgccgctggcgggcgtgccgctcgcg
ctcaaggacgtgttcaccacgaccgacatgcccacgacgtgcggctcgaagatcctcgaa
ggctggcagtccccgtacgacgcgaccgtgacggtcaagctgcgtgccgcgggcatcccg
atcctcggcaagaccaacatggacgagttcgccatgggcagctcgaccgagaactcggcg
tacggcccgacgcgcaacccgtggaacaccgagcgcgtgcctggcggctccggcggcggc
agcgccgccgcgctcgcggcctaccaggcgccgctggccatcggctccgacaccggcggc
tcgatccgccagccggccgcgctgaccgccacggtcggcgtcaagcccacgtacggcacg
gtgtcgcggtacgggctcatcgcgtgcgcttcgtcactggaccagggcggcccgtgcgcg
cgcacggtgctcgacaccgcgctgctgcacgccgtgatcgcaggccacgacgcgcgcgac
tcgacgtcggtcaaggccgacgtgcccgatgtggtcgccgccgccagggccggcgcgacg
ggcgacctcaagggtgtgcgcgtgggtgtggtcaagcagctgcgcggggacggctaccag
ccgggcgtgctgcagtcgttcaacgccgccgtcgagcagctgaccgcgctgggcgccgag
gtcaccgaggtggactgcccgcacttcgaccacgcgatggcggcctattacctgatcctg
ccctcggaggtgtcgagcaacctcgcgcgtttcgacgcgatgcggttcggcctgcgcgtc
ggcgacgacggcacccacagcgccgaagaggtcatggcgctcacacgtgccgccggattc
ggcccagaagtcaagcgccgcatcatgatcggcacatacgcgctttcggcgggctactac
gacgcctactacaaccaggcccagaaggtccggacgctcatcgcgcgcgacctggaccgc
gcgtacgagaacgtcgacgtgctggtgtcgcccgcgacgccgaccaccgcattcggcctg
ggggagaaggtcgacgacccgctggcgatgtacctgttcgacctgtgcacgctgccgctg
aacctggccgggcactgcggcatgtcggtcccgtcgggcctgtcgcccgacgacggtctg
cccgtcggcctgcagatcatggcccccgcgctcgccgacgaccggctctaccgcgtcggc
gcggcctacgaggctgcgcgcggtccgctgccatctgcgctctga

DBGET integrated database retrieval system