KEGG   Mycolicibacterium smegmatis INHR2: LI98_11915Help
Entry
LI98_11915        CDS       T03432                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
msh  Mycolicibacterium smegmatis INHR2
Pathway
msh00473  D-Alanine metabolism
msh00550  Peptidoglycan biosynthesis
msh01100  Metabolic pathways
msh01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:msh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    LI98_11915
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LI98_11915
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    LI98_11915
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:msh01011]
    LI98_11915
Enzymes [BR:msh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     LI98_11915
Peptidoglycan biosynthesis and degradation proteins [BR:msh01011]
 Precursor biosynthesis
  Amino acid ligase
   LI98_11915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_3 RimK CPSase_L_D2 ATP-grasp_4 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: AIU20826
UniProt: Q9ZGN0
LinkDB All DBs
Position
2478428..2479549
Genome map
AA seq 373 aa AA seqDB search
MTAPNHPPGRTRVAVVYGGRSSEHAISCVSAGSILRNLDPERFEVVAIGITPDGSWVLTD
GRPETLAITDGKLPAVTEASGTELALPAAPNRSGQLLALGNGPGEILAAVDVVFPVLHGP
YGEDGTIQGLLELAGVPYVGSGVLASAAGMDKEYTKKLLAAEGLPIGDQVVLRPGVETLD
LEQRERLGLPVFVKPARGGSSIGVSRVTAWDELPAAVALARRHDPKVIVEAAVIGRELEC
GVLEFPDGRLEASTVGEIRVAGVRGREDGFYDFATKYLEDAAELDVPAKVDDDVADEIRQ
LAVRAFTAIGCQGLARVDFFLTDDGPVINEINTMPGFTTISMYPRMWAAGGIDYPTLLAA
MVDTAIARGTGLR
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
gtgactgccccgaaccatcctcctggccgcacccgcgtcgccgtcgtctacggcgggcgt
agctcggagcacgcgatctcgtgcgtgtcggcgggcagcatcctgcgcaacctcgatccg
gagcgtttcgaggtcgtcgccatcggcatcacgcctgacggctcgtgggtgctcaccgac
ggtcggcccgagacgctcgcgatcaccgacggcaaactgcccgcggtgaccgaggcgtcg
ggcaccgaactcgcgctgcccgccgcgcccaaccgcagcggccagttgctggcgctgggc
aacggccccggcgagatcctcgccgcggtcgatgtggtgttccccgtgctgcacggtccg
tacggcgaagacggcaccatccagggcctgctcgaactcgcaggcgtgccctacgtggga
tcgggcgtgctggccagcgccgccggtatggacaaggagtacaccaagaagctgctcgcc
gccgaggggctgccgatcggcgatcaggtggtcctgcgtcccggcgtcgagaccctcgac
ctcgaacagcgtgagcggctcggcctgccggtcttcgtcaaacccgcgcgcggcggatcc
tcgatcggcgtcagccgggtcaccgcgtgggacgaactgcccgcagcggtcgcgctggcg
cgccgccatgacccgaaggtcatcgtcgaggccgcggtgataggccgtgaattggagtgc
ggtgtcctggagttccccgatggccgtctcgaggccagcacggtcggcgagatccgcgtg
gccggtgtgcgcggccgcgaggacgggttctacgacttcgccaccaaatacctcgaggac
gcggccgaactcgacgtgcccgccaaggtcgacgacgacgtcgccgacgagatccggcag
ctcgcggtgcgcgcgttcaccgcgatcggctgccagggcctcgcacgcgtcgacttcttc
ctcaccgacgacggtccggtgatcaacgagatcaacaccatgccggggttcaccaccatc
tcgatgtacccgcggatgtgggccgccggcggtatcgactatccgacgctgctggccgcg
atggtcgacaccgcgatcgcgcggggcaccggcctgcgctga

DBGET integrated database retrieval system