KEGG   Mycolicibacterium smegmatis INHR2: LI98_12365Help
Entry
LI98_12365        CDS       T03432                                 

Definition
(GenBank) IclR family transcriptional regulator
Organism
msh  Mycolicibacterium smegmatis INHR2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IclR HTH_IclR MarR_2 HTH_11 HTH_24 TrmB Sigma70_r4 HTH_20 HTH_Crp_2 Rrf2 HTH_5 HTH_AsnC-type MarR Dimerisation HTH_26 HTH_3 HTH_23 Sigma54_DBD
Motif
Other DBs
NCBI-ProteinID: AIU20912
UniProt: A0A0D6HV67
LinkDB All DBs
Position
2565419..2566141
Genome map
AA seq 240 aa AA seqDB search
MADIGRSTLVLDALAEASKPLTLSELATRTGLPRSTVHRIVQSLERSLYLVRGVDRHGYS
LGPGLLKFGMNAHLRLLAGNRPLLARLVREVGENVELAIFSGREVVVVDQLASVNRLHGV
TKVGKSFSLHASCIGLALLAHLPDDQVAGLLSPPLQRFTEHTVTDLPAIMGRLDEVRRTQ
IAVDTEEHDVGICAVATAFPGPTGALQAVAVVMPTARFRAKRERAVESLQRINPLLAHRN
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
gtggctgacataggccggtccacgctggtgctggacgcgctcgccgaagcgtcgaagcca
cttacgctgagtgagctcgccactcgcacgggactgcctcgctccacggtgcatcgcatc
gtgcagtctcttgagcgcagtctgtacctggtgcggggagtcgaccgccacggttactct
ctgggcccaggcctgctcaagttcgggatgaacgcgcatctgcgcctgctggccggcaac
cgccccctgctggcccgtcttgtgcgtgaggtgggcgagaacgtcgaactggccatattc
agcgggcgcgaagtggtggtggtcgaccaactcgcgtcggtgaaccgactgcacggcgtc
accaaggtcgggaagagcttctcgctgcacgccagttgtatcggcctggcgctcttggcc
catctgcccgacgatcaggtggcagggcttctctcgccaccgctgcagcggttcaccgaa
cacaccgtcacggacctgcccgccatcatgggcaggctcgacgaggtgcgacgtacccag
atcgccgtggacaccgaggagcacgacgtggggatctgcgcggtcgccaccgccttccca
gggcctaccggcgctctgcaggcggtggcggtcgtcatgcccaccgcgcgattccgggca
aagcgtgagcgggccgtcgagagcctccaacggatcaacccgctgctcgcgcaccgcaac
tga

DBGET integrated database retrieval system