KEGG   Mycobacterium smegmatis INHR2: LI98_12385Help
Entry
LI98_12385        CDS       T03432                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
msh  Mycobacterium smegmatis INHR2
Pathway
msh00250  Alanine, aspartate and glutamate metabolism
msh00410  beta-Alanine metabolism
msh00640  Propanoate metabolism
msh00650  Butanoate metabolism
msh01100  Metabolic pathways
msh01120  Microbial metabolism in diverse environments
Module
msh_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:msh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    LI98_12385
   00650 Butanoate metabolism
    LI98_12385
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LI98_12385
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LI98_12385
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:msh01007]
    LI98_12385
Enzymes [BR:msh01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     LI98_12385
Amino acid related enzymes [BR:msh01007]
 Aminotransferase (transaminase)
  Class III
   LI98_12385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AIU20916
UniProt: A0A0D6HVT2
LinkDB All DBs
Position
complement(2570276..2571529)
Genome map
AA seq 417 aa AA seqDB search
MTELSQALKQATGVIAARGEGVLLYDEQDRRYLDFTAGIGVTSTGHCHPRVVEAAQRQVG
TLIHGQYTTVMHRPLLTLVERLGEVLPAGLDRMFFANSGSEAIEAALRLSRQATGRPNVI
VFHGGFHGRTVAAASMTTSGTKFRSGFSPLMAGVHVSPFPDPTHFGWPVEQTTDFALSQL
DYVLQTVSAPADTAAFFVEPVLGEGGYVPANERFLAGLRERADAHGILLVLDEVQTGYGR
TGKFWGGEHFDAKPDILVTAKGLASGFPLSGIAASSELMAKAWPGSQGGTYGANAVACAA
AIATLDVIADENLVANAAERGAQLKQALQTVADKHEQITDVRGLGLMIGNEFRDADGKPD
GTTAAAVQQEAARRGLLLLTCGAWGQVVRFIPALVVSADEVEEAAGIWADAVSAVVS
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgaactttcgcaggccctcaagcaggcaaccggcgtgatcgccgcccgcggcgag
ggcgtcctgctctacgacgaacaggaccgccgatacctcgatttcaccgcgggtatcggt
gtgacgagcaccggacactgccatccccgggtcgtcgaggccgcgcagcgacaggtgggg
acgctcatccacgggcagtacaccacggtcatgcaccggccactgctcaccctggtggag
cggctcggtgaggtgctcccggccgggctggaccggatgttcttcgccaactccggcagc
gaggccatcgaggccgcgctgcggctcagcaggcaggccaccggccgtcccaacgtcatc
gtcttccacggcggctttcacggcaggaccgtggccgcggcgtcgatgaccacctccggc
accaaattccggtcggggttcagcccactgatggccggcgtgcacgtatcgccgttcccc
gatcccacccacttcggttggcccgtcgaacagaccaccgatttcgcactctcgcaactc
gattacgtgctgcagacggtgagcgcgccggccgacaccgccgcgttcttcgtcgaaccc
gtgctgggcgagggcggttatgttccggccaacgagcgtttcctcgccggactgcgggaa
cgcgccgatgcgcacggcatcctgttggtgctcgacgaggtgcagaccggatacggccgc
acgggaaagttctggggcggcgagcatttcgacgccaaaccggacatcctggtgacggcc
aaaggcctggcgtcgggcttcccgctgtccgggatcgccgcgtcgtcggagttgatggcc
aaggcgtggccggggtcgcagggcggcacctacggggccaacgcggtggcctgcgcggcc
gcgatcgcgaccctcgacgtgatcgcggacgagaacctcgtcgccaatgccgcggagcgc
ggcgcacagctcaagcaggctctgcagacggtcgccgacaagcacgagcagatcaccgac
gtccgcggactcgggttgatgatcggcaacgaattccgcgacgccgacggcaaacccgac
ggcaccaccgcggccgcggtgcagcaggaggcggcccgccgcgggttgctgctgctgacg
tgcggcgcgtggggtcaggtggtgcgcttcatccccgcgctcgtcgtctccgccgatgag
gtggaagaggccgcgggcatctgggccgacgccgtgagcgccgtcgtgtcctga

DBGET integrated database retrieval system