KEGG   Mycolicibacterium smegmatis INHR2: LI98_12805Help
Entry
LI98_12805        CDS       T03432                                 

Definition
(GenBank) polyketide cyclase
Organism
msh  Mycolicibacterium smegmatis INHR2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Polyketide_cyc2
Motif
Other DBs
NCBI-ProteinID: AIU20999
LinkDB All DBs
Position
complement(2656089..2656562)
Genome map
AA seq 157 aa AA seqDB search
MGIVTTSSETAFPQSAETVYDFVTNPANWTKTYPGSAHIEGLPDRLPLQVGDTWSEAGPD
GQQIYTWHLAIAMRPRLWVFNSVGRLGHDRDGNGGMDGRITVQYQFTRPGPDVTLFSRTM
TIEAYKESPLPDALFRIVNPANIDRYHAAVARELAGV
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
ttgggcatcgtgaccaccagctcggagacggcattcccccaatcggcggaaactgtctac
gatttcgtgaccaacccggcgaactggaccaagacctaccctggcagcgcgcacatcgag
ggcctgccggaccggttgccgttgcaggtcggggacacctggagcgaggcaggcccggac
ggccagcagatctacacgtggcatctcgcgatcgcgatgcgtccgcggttgtgggtgttc
aactccgtcggccggctcgggcacgatcgggacggcaacggcggcatggacggccggatc
accgtgcagtaccagttcacgcgtccaggcccggacgtcacgttgttcagccgcaccatg
accatcgaggcctacaaggaatccccgttgcccgatgcgctgttccgcatcgtgaacccg
gccaacatcgacaggtaccacgccgcggtcgcgcgcgaactcgcaggcgtctga

DBGET integrated database retrieval system