KEGG   Mycolicibacterium smegmatis INHR2: LI98_12880Help
Entry
LI98_12880        CDS       T03432                                 

Definition
(GenBank) methionine aminopeptidase
  KO
K01265  methionyl aminopeptidase [EC:3.4.11.18]
Organism
msh  Mycolicibacterium smegmatis INHR2
Brite
KEGG Orthology (KO) [BR:msh00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:msh01002]
    LI98_12880
Enzymes [BR:msh01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.18  methionyl aminopeptidase
     LI98_12880
Peptidases and inhibitors [BR:msh01002]
 Metallo peptidases
  Family M24
   LI98_12880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M24 CBM39
Motif
Other DBs
NCBI-ProteinID: AIU21014
LinkDB All DBs
Position
2668956..2669813
Genome map
AA seq 285 aa AA seqDB search
MSVRSALRPGVLSPTLPVPKSIPRPEYAWKPTVQEGSEPWVQTPEVIEKMRVAGRIAAGA
LAEAGRAVAPGVTTDELDRIAHEYMIDHGAYPSTLGYKGFPKSCCTSLNEIICHGIPDST
VIEDGDIVNIDVTAYIDGVHGDTNATFLAGDVSEEHRLLVERTHEATMRAIKAVKPGRAL
SVVGRVIEAYANRFGYNVVRDFTGHGIGTTFHNGLVVLHYDQPAVETVLEPGMTFTIEPM
INLGTLDYEIWDDGWTVATTDGKWTAQFEHTLVVTEDGAEILTQL
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgtccgttcgtagtgccctgcgccccggcgtgctctcacccacccttccggtgcccaag
tcgatcccgcgtcccgagtacgcgtggaagccgacggtgcaggaaggcagcgaaccgtgg
gtgcagacgcccgaggtcatcgagaagatgcgcgtggcgggccgcatcgcggcaggcgcc
ctggccgaggcgggcagggccgtcgcccccggtgtgacgaccgacgaactcgaccgcatc
gcgcacgagtacatgatcgaccacggtgcgtacccgtcgacgttgggctacaagggcttt
ccgaaatcctgctgcacgtcgctgaacgagatcatctgccacggcatcccggactcgacc
gtgatcgaggacggtgacatcgtcaacatcgacgtcacggcctacatcgacggtgtgcac
ggcgacaccaacgccacgttcctcgcgggcgacgtctccgaggagcaccgtctgctcgtc
gagcgcacgcacgaggccaccatgcgcgccatcaaggccgtcaagcccgggcgtgccctg
tcggtggtcggccgggtgatcgaggcgtacgcgaaccggttcggctacaacgtcgttcgt
gacttcaccggtcacggcatcggcaccacgttccacaacggcctggtggtgctgcactac
gaccagcccgcggtcgagaccgtgctcgagcccggcatgacgttcaccatcgagcccatg
atcaacctcggcacgctcgactacgagatctgggacgacggctggaccgtggccaccacc
gacggcaagtggaccgcgcagttcgagcacaccctcgtggtcaccgaggacggcgccgag
atcctcacccagttgtga

DBGET integrated database retrieval system