KEGG   Mycolicibacterium smegmatis INHR2: LI98_12915Help
Entry
LI98_12915        CDS       T03432                                 

Definition
(GenBank) asparagine synthase
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
msh  Mycolicibacterium smegmatis INHR2
Pathway
msh00250  Alanine, aspartate and glutamate metabolism
msh01100  Metabolic pathways
msh01110  Biosynthesis of secondary metabolites
msh01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:msh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LI98_12915
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:msh01002]
    LI98_12915
Enzymes [BR:msh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     LI98_12915
Peptidases and inhibitors [BR:msh01002]
 Cysteine peptidases
  Family C44
   LI98_12915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 tRNA_Me_trans DUF1933 NAD_synthase
Motif
Other DBs
NCBI-ProteinID: AIU21021
UniProt: A0A0D6HXR5
LinkDB All DBs
Position
complement(2675764..2677569)
Genome map
AA seq 601 aa AA seqDB search
MCGATGEVRLDGRTPDIGAVSAMAETMSSRGPDAAGVWSQGRVALGHRRLKIIDLTEAGA
QPMIDPELGLAVCWNGCIYNYKELRAELSGHGYRFFSHSDTEVLIKAYHHWGDRFVEHLK
GMFAFAIAERDTGRVLLGRDRLGIKPLYLSETGDRIRFASSLPALLAGGGVDTGIDSVAL
HHYLTFHSVVPPPRTILRGVKKVPPASIVAIEPDGTQRTTVYWSPDFSRRAERADWSERD
WEDAVLQSLREAVERRLVADVPVGCLLSGGVDSSLIVGLLAEAGQHGLKTFSIGFESVNG
VAGDEFKYSDIVAQHFGTDHHQIRIDTARMLPALDGAIAAMSEPMVSHDCVAFYLLSQEV
AKHVKVVQSGQGADEVFAGYHWYPPMAEPAAASLDGAVNSYRGAFFDRDSAGVASLISDA
YRVDGDPSGVFVTDHFGAPGAETGVDRALRLDTTVMLVDDPVKRVDNMTMAWGLEGRVPF
LDHELVELAATCPPELKTAHGGKGVLKEAARRVIPAAVIDRPKGYFPVPALTHLEGPYLN
MVRDALYAPEAKERGLFRPEAVERLLADPNGRLTPLRGNELWQIGLLELWLQRHGITGSA
A
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggagccaccggagaggtgcgtctcgatggccggacaccagatatcggcgcggtg
tcggccatggcagagacgatgtcgtccaggggacccgatgcggcgggcgtgtggtcgcag
gggcgggtagcgctgggccaccgacgactgaaaatcattgatctgaccgaagcgggcgcg
caaccgatgatcgaccccgaactggggttggccgtctgttggaacggctgcatctacaac
tacaaggaactgcgcgccgagctgtccgggcacgggtaccggttcttctcccacagcgac
accgaggtgctgatcaaggcctatcaccactggggtgatcgtttcgtggaacacctcaag
gggatgttcgcgttcgcgatcgccgagcgtgacaccggccgggtgctgctgggtcgcgac
cggctcggtatcaagccgctgtacctcagcgagacgggcgaccgcatccggttcgcgtcg
tcgctgcccgcgctgctggcaggcggcggtgtcgacaccgggatcgactcggtcgcgctg
caccactacctgacgttccactcggtggtgccgccgccacggacgatcctgcgcggcgtc
aagaaggtgccgcccgcgtcgatcgtggcgatcgagcccgacgggacgcagcgcaccacg
gtctactggtcgcccgatttctcgcggcgcgccgaacgtgccgactggtccgagcgggac
tgggaagacgcagtgctgcagtcacttcgggaagccgtcgagcgacgcctggtggccgac
gtgccggtggggtgcctgctctcgggcggggtcgactccagcctgatcgtgggcctgctc
gccgaggcgggccagcacgggctcaagaccttctcgatcggcttcgaatccgtcaacggt
gtcgcaggcgacgagttcaagtactccgacatcgtcgcccagcacttcggcaccgaccac
caccagatccgcatcgacaccgcgcgcatgctgcccgcactcgacggtgcgatcgcggcg
atgagcgaaccgatggtgagccacgactgtgtggcgttctatctgctgagccaggaagtg
gccaagcacgtcaaggtggtgcagtccggtcagggcgccgacgaggtgttcgcgggctac
cactggtatccgcccatggccgagccggccgccgcatcgctcgacggcgcggtgaacagc
taccgcggtgcgttcttcgaccgcgacagcgcgggcgtcgcgagtctcatcagcgacgcg
taccgggtcgacggagatccgagcggcgtgttcgtcaccgaccacttcggtgcgccgggc
gccgagaccggcgtcgaccgggcgctgcgcctggacaccacggtgatgctggtcgacgat
ccggtcaagcgtgtcgacaacatgaccatggcgtggggcctggagggccgggtgccgttc
ctcgaccacgaactcgtcgagctcgcggcgacctgcccgcccgaactcaagaccgcccac
ggcggcaaaggcgtgctgaaagaggctgcgcgacgggtgatcccggccgcggtgatcgac
cggcccaagggctacttccccgtgcccgcgctgacccatctcgaggggccgtacctcaac
atggtgcgcgacgcgctgtacgcgcccgaggccaaagagcgcgggctgttccggcccgag
gcggtggaacggcttctcgccgaccccaacggcaggctgacgccgctgcgcggcaacgag
ttgtggcagatcggtctgctggagttgtggttgcagcgtcacggcatcaccgggagcgcg
gcatga

DBGET integrated database retrieval system