KEGG   Mycolicibacterium smegmatis INHR2: LI98_14735Help
Entry
LI98_14735        CDS       T03432                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
msh  Mycolicibacterium smegmatis INHR2
Pathway
msh00250  Alanine, aspartate and glutamate metabolism
msh00280  Valine, leucine and isoleucine degradation
msh00410  beta-Alanine metabolism
msh00640  Propanoate metabolism
msh00650  Butanoate metabolism
msh01100  Metabolic pathways
msh01120  Microbial metabolism in diverse environments
Module
msh_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:msh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    LI98_14735
   00650 Butanoate metabolism
    LI98_14735
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LI98_14735
   00280 Valine, leucine and isoleucine degradation
    LI98_14735
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LI98_14735
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:msh01007]
    LI98_14735
Enzymes [BR:msh01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     LI98_14735
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     LI98_14735
Amino acid related enzymes [BR:msh01007]
 Aminotransferase (transaminase)
  Class III
   LI98_14735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AIU21364
LinkDB All DBs
Structure
PDB: 

Position
complement(3021123..3022463)
Genome map
AA seq 446 aa AA seqDB search
MSHPEQSRHLATAIPGPRSQALIDRKGTAVARGVGTTMPVYAVRAGGGIVEDVDGNRLID
LGSGIAVTTVGNSAPKVVEAVRSQVGDFTHTCFMVTPYEGYVAVCEQLNRLTPVRGDKRS
ALFNSGSEAVENAVKIARSHTHKPAVVAFDHAYHGRTNLTMALTAKVMPYKDGFGPFAPE
IYRAPLSYPFRDAEFGKELATDGELAAKRAITVIDKQIGADNLAAVVIEPIQGEGGFIVP
ADGFLPTLLDWCRKNDVVFIADEVQTGFARTGAMFACEHEGIDPDLIVTAKGIAGGLPLS
AVTGRAEIMDSPHVSGLGGTYGGNPIACAAALATIETIESEGLVARAQQIEKIMKDRLGR
LQAEDDRIGDVRGRGAMIAMELVKAGTTEPDADLTKALCAGAHAAGVIVLSCGTYGNVVR
FLPPLSIGDDLLNEGLDVLEEVLRGA
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
gtgagccatcccgagcagagccgccatctcgccaccgccatacctgggccgagatcccag
gcactgatcgacaggaagggcacagccgtcgcccgcggcgtcggcaccacgatgccggtc
tacgcggtcagggccggcggcggcatagtcgaggatgtcgacggcaaccggctgatcgac
ctcggatcaggcattgccgtcaccaccgtgggcaactccgcgccgaaggtcgtcgaggcc
gtgcgcagccaggtcggcgacttcacccacacatgcttcatggtgacgccgtacgagggg
tacgtcgcggtctgcgagcaactcaaccggctgaccccggtccgcggtgacaaacgctcg
gccctgttcaactcgggttcggaggccgtcgagaacgccgtcaagatcgcgcggtcccac
acgcacaaacccgcggtcgtcgcgttcgatcacgcctatcacggccgcaccaacctgacc
atggcgctgacggccaaggtcatgccgtacaaggacgggttcggaccgttcgcgccggag
atctaccgcgcgccgctttcctatcccttccgcgatgccgagttcggcaaggaactggcg
accgacggcgaactggcggccaagcgcgcgatcaccgtcatcgacaagcagatcggcgcc
gacaacctcgccgcggtcgtcatcgagccgatccagggtgagggtggcttcatcgtgccc
gccgacggtttcctgccgacgctgctcgactggtgccgcaagaacgatgtggtgttcatc
gccgacgaggtccagacgggtttcgcgcgcacgggcgcgatgttcgcgtgcgagcacgag
ggcatcgatcccgatctgatcgtcaccgccaagggcatcgcaggcggcctgccgctgtcg
gcggtcaccggacgcgccgagatcatggactcgccgcacgtgtcgggactcggtggcacg
tacggcggcaacccgatcgcgtgcgcggccgcgctggcgaccatcgagaccatcgaatcc
gaggggctcgtggcgcgtgcgcagcagatcgagaagatcatgaaggaccggctcggacgc
ctgcaggccgaggacgaccgcatcggggatgtgcggggccgcggcgcgatgatcgcgatg
gaactggtcaaggccggcaccaccgaacccgatgccgacctgaccaaggccctgtgcgca
ggtgcgcacgccgcgggggtgatcgtattgtcttgcggcacttacggaaacgtggtgcgt
ttcctgccgccgttgtcgatcggtgacgatctgctcaacgagggactcgacgtcctcgaa
gaggtcctccgcggcgcgtga

DBGET integrated database retrieval system