KEGG   Mycobacterium smegmatis INHR2: LI98_27555Help
Entry
LI98_27555        CDS       T03432                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
msh  Mycobacterium smegmatis INHR2
Pathway
msh03030  DNA replication
msh03410  Base excision repair
msh03420  Nucleotide excision repair
msh03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:msh00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    LI98_27555
   03410 Base excision repair
    LI98_27555
   03420 Nucleotide excision repair
    LI98_27555
   03430 Mismatch repair
    LI98_27555
Enzymes [BR:msh01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     LI98_27555
    6.5.1.6  DNA ligase (ATP or NAD+)
     LI98_27555
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     LI98_27555
DNA replication proteins [BR:msh03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    LI98_27555
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     LI98_27555
DNA repair and recombination proteins [BR:msh03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     LI98_27555
   NER (nucleotide excision repair)
    Other NER factors
     LI98_27555
   MMR (mismatch exicision repair)
    Other MMR factors
     LI98_27555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C RNA_ligase Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: AIU23837
LinkDB All DBs
Position
complement(5656907..5659174)
Genome map
AA seq 755 aa AA seqDB search
MERYERVRLTNPDKVLYPATGTTKAEVFDYYLSIAQVMVPHIAGRPVTRKRWPNGVAEEA
FFEKQLASSAPSWLERGSITHKSGTTTYPIINTREGLAWVAQQASLEVHVPQWRFEDGDQ
GPATRIVFDLDPGEGVTMTQLCEIAHEVRALMTDLDLETYPLTSGSKGLHLYVPLAEPIS
SRGASVLARRVAQQLEQAMPKLVTATMTKSLRAGKVFLDWSQNNAAKTTIAPYSLRGRDH
PTVAAPRTWDEIADPELRHLRFDEVLDRLDEYGDLLAPLDADAPIADKLTTYRSMRDASK
TPEPVPKEIPKTGNNDKFVIQEHHARRLHYDLRLERDGVLVSFAVPKNLPETTAENRLAV
HTEDHPIEYLAFHGSIPKGEYGAGDMVIWDSGSYETEKFRVPEELDNPDDSHGEIIVTLH
GEKVDGRYALIQTKGKNWLAHRMKDQKNARPEDFAPMLATEGSVAKYKAKQWAFEGKWDG
YRVIIDADHGQLQIRSRTGREVTGEYPQFKALAADLAEHHVVLDGEAVALDESGVPSFGQ
MQNRARSTRVEFWAFDILWLDGRSLLRAKYSDRRKILEALADGGGLIVPDQLPGDGPEAM
EHVRKKRFEGVVAKKWDSTYQPGRRSSSWIKDKIWNTQEVVIGGWRQGEGGRSSGIGALV
LGIPGPEGLQFVGRVGTGFTEKELSKLKDMLKPLHTDESPFNAPLPKVDARGVTFVRPEL
VGEVRYSERTSDGRLRQPSWRGLRPDKTPDEVVWE
NT seq 2268 nt NT seq  +upstreamnt  +downstreamnt
atggagcgctatgagcgggttcgcctgacgaatcctgacaaggtgctctatcccgccacg
ggcaccaccaaggcagaggttttcgactactacctcagcatcgcgcaggtgatggtgccg
cacatcgccgggcggccggtgacgcgcaaacgctggcccaacggcgtcgcggaagaggcg
ttcttcgagaagcagttggcgtcgtcggccccgagctggctggaacgtggctcgatcacg
cacaaatcgggcaccacgacgtacccgatcatcaacacgcgtgagggtctggcgtgggtc
gcgcagcaggcctcgctggaagtgcatgtgccgcaatggcgcttcgaggacggggatcag
ggtccggccacgcggatcgtgttcgacctcgatccgggcgaaggcgtcacgatgacgcaa
ttgtgcgagatcgcccacgaggtgcgcgcgctgatgaccgacctcgatctcgagacgtac
ccgctcaccagcggcagcaagggcctgcacctgtatgtgccactggccgagccgatcagc
tcccgcggcgcgtcggtgctcgcgcgccgggttgcccagcagctggagcaggccatgccg
aagctggtcaccgccaccatgaccaagagcctgcgggctggcaaggtgttcctggattgg
agccaaaacaacgcggccaagactacgatcgcgccgtactcgctgcgggggcgcgaccat
ccgacggtcgccgcgccgcgtacgtgggacgagatcgccgatccggaactgcggcatctg
cggttcgacgaggtactggaccggctcgacgaatacggtgatctactggcaccgctcgac
gccgacgcaccgatcgccgacaagctcacgacctaccgcagcatgcgcgacgcgtcgaag
acgcccgagccggtgccgaaagagattccgaagaccggtaacaacgacaagttcgtcatc
caggagcaccacgcccggcggctgcactatgacctgcgactcgagcgtgacggtgttctc
gtgagcttcgcggtgcccaagaacctgcccgagaccaccgcggagaaccggctcgcggtg
cacaccgaggaccaccccatcgagtacctggcgtttcacggctcgattcccaagggcgag
tacggcgccggtgacatggtgatctgggattcgggtagctacgagaccgagaagttccgt
gtgcccgaggaactcgacaaccctgacgacagtcacggcgagatcatcgtcacgctgcac
ggcgagaaggtcgacggcaggtatgcgttgatccagaccaagggcaagaactggctcgcg
caccgcatgaaggaccagaagaacgcgcggccagaggatttcgcgcccatgctggccacc
gagggttccgtcgcgaagtacaaggccaagcagtgggcgttcgagggcaaatgggacggc
taccgcgtgatcatcgacgccgatcacggccagttgcagatacgttcgcgcaccggtcgt
gaggtgaccggtgagtacccccaattcaaggcgctggcagccgatctcgccgaacatcat
gtggtgctcgacggcgaggcggtcgcgttggacgagtcaggtgtgcccagtttcggccag
atgcagaaccgtgcccgctccacgcgggtcgagttctgggccttcgacatcctgtggctc
gacggccggtcgctgttgcgggccaagtactccgaccggcgcaagatcctggaagcgctg
gccgacggtggcggactgatcgtcccggaccagttgcccggcgacgggcccgaggccatg
gagcacgtgcgcaagaaacgcttcgagggtgtcgtcgccaagaaatgggactcgacgtat
caaccaggtcgacggtcgtcatcgtggatcaaggacaagatctggaacacccaggaggtc
gtgatcggcggttggcgtcagggtgagggtggacggtccagcggtatcggcgcactcgtg
ctcggcattccggggcccgaaggcctgcagttcgtgggacgcgtcggaacggggttcacc
gagaaagaactgagcaagctcaaggacatgctgaagccgctgcacaccgacgagtccccc
ttcaacgcgccactgcccaaggtcgacgcccgcggcgtcaccttcgtgcgcccggaactg
gtgggggaggtgcgctacagcgagcgcacatcggacggccggttgcgtcaaccgagttgg
cgtgggctgcgccccgacaagacacccgatgaggttgtgtgggaatag

DBGET integrated database retrieval system