KEGG   Mycolicibacterium smegmatis INHR2: LI98_31170Help
Entry
LI98_31170        CDS       T03432                                 

Gene name
ligC
Definition
(GenBank) ATP-dependent DNA ligase
Organism
msh  Mycolicibacterium smegmatis INHR2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: AIU24540
UniProt: A0A0D6J2V0
LinkDB All DBs
Position
6369472..6370536
Genome map
AA seq 354 aa AA seqDB search
MDLPVLPPVSPMLSKSVNQIPPGMSYEPKWDGFRSILFRDGAEVELGSRKERPMTRYFPE
LVAAALTELPDRCVIDGEIVLPADNHLDFEALQLRLHPAASRVAMLAEQTPAAFIAFDLL
ALGDDDYTGRPFSERRAALETALADAGPTFHLTPATTDLPTAQRWFHEFEGAGLDGVIAK
PLDLTYQPDKRVMFKVKHQRTADCVVAGYRLHKSGADAVGSLLLGLYDDDGSLASVGVIG
AFPMATRRALFTELQTLVADFDHHPWNWAAQAAADPELARRYGGGSRWNAGKDLSFVPLR
PERLVEVRYDHMEGRRFRHTAQFNRWRPDRDARSCTFAQLDSPPHSSSVTSCRV
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggacctgcccgtgctgcctccggtgtcgcccatgctgtcgaagtccgtgaaccagatc
ccgccggggatgtcgtatgaacccaagtgggacgggttccggtcgatcctgttccgcgac
ggcgccgaggtggaactcggcagccgcaaggaacggcccatgacccgctactttcctgaa
ttggtggccgcggcgctgaccgagcttcccgaccgctgcgtgatcgacggcgagatcgtc
ctaccggccgacaaccacctcgacttcgaggcgctgcaactgcgtctgcaccccgccgcg
agccgggtggcgatgctcgccgaacagacgcccgcagcgttcatcgcgttcgatctgctg
gcactcggcgacgacgactacaccggccgaccgttcagcgagcgtcgcgccgcgctcgag
accgccctcgcggatgccggcccgacgttccacctgacgcccgccaccaccgatctgccg
actgcgcagcgctggttccacgagttcgaaggcgccggtctcgacggggtcatcgccaaa
cccctggacctgacctaccagccggacaagcgcgtcatgttcaaggtcaagcaccagcgc
accgcggactgcgtggtcgccgggtaccggctgcacaaatccggcgccgacgccgtgggc
tcgctgctgctcgggttgtacgacgacgacggcagcctcgcgtcggtcggcgtcatcggc
gccttcccgatggcgacccggcgggcgctgttcaccgaactgcagacgctggtagccgat
ttcgaccatcacccgtggaactgggccgcgcaggccgcggccgatccggaactcgcccga
cgctacggcggcgggtcacgctggaatgcgggcaaggatctgtcgttcgtcccgcttcgc
cccgaacgcctggtcgaggtgcgctacgaccacatggagggccgccggttccggcacacc
gcgcagttcaaccgctggcgcccggaccgcgacgcgcgttcgtgcacattcgcacagctc
gactccccaccgcattcgagctcggtgacatcgtgccgggtttag

DBGET integrated database retrieval system