KEGG   Mycobacterium shigaense: MSG_00020Help
Entry
MSG_00020         CDS       T05717                                 

Gene name
pknA
Definition
(GenBank) serine/threonine-protein kinase PknA
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mshg  Mycobacterium shigaense
Brite
KEGG Orthology (KO) [BR:mshg00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mshg01001]
    MSG_00020 (pknA)
Enzymes [BR:mshg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     MSG_00020 (pknA)
Protein kinases [BR:mshg01001]
 Serine/threonine kinases: Other
  Bacterial family
   MSG_00020 (pknA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kdo Kinase-like Pkinase_fungal Haspin_kinase RIO1
Motif
Other DBs
NCBI-ProteinID: BAX90188
UniProt: A0A1Z4EB59
LinkDB All DBs
Position
complement(19749..21074)
Genome map
AA seq 441 aa AA seqDB search
MSPRVGVTLSGRYRLQRLIATGGMGQVWEAVDSRLGRRVAVKVLKGEFSQDPEFIERFRA
EARTTAMLNHPGIAAVHDYGESQLDGEGRTAYLVMELVNGEPLNSVLKRTGRLSLRHALD
MLEQTGRALQVAHAAGLVHRDVKPGNILITPTGQVKITDFGIAKAVDAAPVTQTGMVMGT
AQYIAPEQALGHDATPASDVYSLGVVGYEVVSGKRPFTGDGALTVAMKHIKEPPPPLPPE
LPPNVRELIEITLVKNPGMRYRSGGPFADAVAAVRAGRRPPRPSQSPPPGRASPASIPST
QQARPTPVGGRTPPPRRTSPSGRGHRPPPARRTFSSGQRALLWAAGVLGALAIIIAVLIV
INSKADTQQQQQPTVTDTGTPPASGAPPPSKTPNGSAPRLRLDWTDEAAIRNSGVQSRPP
PLGWAHPLTPTRSAAGPEIAQ
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgagcccgcgcgttggagtgacgctgtccggccggtaccggctgcagcgcctgatcgcc
accggcggcatgggccaggtctgggaggcggtggacagccggctgggccggcgggtcgcg
gtcaaggtactcaagggggagttctcccaggaccccgaattcatcgagcggttccgcgcc
gaggcgcgcaccacggcaatgctcaaccatcccgggatcgccgccgtgcacgactacggc
gaaagccagctggacggggagggccgcaccgcctatctggtgatggagctcgtaaatggc
gagccgctgaactcggtgctcaagcgcaccgggcggctgtcgctgcgccacgccctggac
atgctcgagcaaacgggccgcgccctacaggtcgcgcacgccgccgggctggtgcaccgc
gacgtcaagcccgggaacatcctgatcacgccgacaggacaggtcaagatcaccgacttc
ggcatcgccaaggcggtcgacgccgcaccggtgacccagaccggcatggtgatgggcacc
gcccaatacatcgcgcccgaacaggcgctgggccacgacgccacccccgccagcgacgtc
tactcgctgggagttgttggctacgaggtggtttcgggcaagcgcccattcaccggtgac
ggggcgttgacggtggcgatgaagcacatcaaagaaccgccgccgccgctgccgcccgag
ctgccgcccaacgtgcgcgaactcatcgagatcacactggtgaagaaccccggcatgcgc
tatcgcagcggcggaccgttcgccgacgcggtcgccgcggtccgggctggccggcggccg
ccgcggcccagccagtcgccgcccccgggacgcgcctcaccggcatccatcccgtcgacc
cagcaggcccgccccacccccgtgggcggccgcaccccgcccccgcgccgaaccagcccg
tcgggccggggtcaccggccgcccccggcgcgccgcacgttctcgtcggggcagcgcgcg
ctgttgtgggccgccggggtgctcggggcgctcgcgatcatcatcgccgtgctgatcgtc
atcaattccaaggcggacacgcagcagcaacagcagccgacggttaccgacaccggcacg
ccaccggccagcggcgcaccgccgccgtcgaagacgccgaacggttccgcgccccgcctg
cggctggattggacggatgaggcggcgatacgtaattctggtgtccagagcaggccgccc
ccactgggctgggcacaccccttgacgcccacccggtcggcggccggacccgagatagcg
caatga

DBGET integrated database retrieval system