KEGG   Mycobacterium shigaense: MSG_02685Help
Entry
MSG_02685         CDS       T05717                                 

Definition
(GenBank) putative zinc-binding alcohol dehydrogenase
Organism
mshg  Mycobacterium shigaense
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C
Motif
Other DBs
NCBI-ProteinID: BAX92829
UniProt: A0A1Z4EIM2
LinkDB All DBs
Position
2849657..2850682
Genome map
AA seq 341 aa AA seqDB search
MRTVVVDGPRSIRVDTRPDPALPGPDGAIVEVSAAGICGSDLHFYEADFPMPGPIALGHE
AVGTVVEVGPDVRTVRAGDQVMISSVTGCGACPGCATNDPVLCHSGFQIFGGGVLGGAQA
DLLAVPAADFQLLKMPEGISTEQALLLTDNLATGWAAAQRADIPFGGTVAVIGLGAVGLC
SLRSALFHGAATVFAVDQVDGRLDRAGRWGATPVKAPAIEAILAATGGRGADAVIDAVAT
DASLTEAINTVRPGGTVSVVGVHDMNPFPLNALGCLIRSTTVRFTTAPVQRTWPELIPLL
QSGRLDVDGIFTTTLPLDEAAKGYATAESRSGDDVKILLTP
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgcgcacggtagtcgtcgacgggccccgcagcatccgggtcgacacccgtcccgatccc
gcccttcccggacccgacggggcgatcgtcgaagtgagcgcggccggcatctgcggatcc
gacctgcacttctacgaggccgactttccgatgcccggcccgatcgcgctgggccatgag
gcggttggcacggtcgtggaggtcggccccgacgtgcgcacggtccgggccggcgaccaa
gtcatgatttcttcggtgaccggctgcggcgcctgccccggatgcgccaccaacgatccg
gtcttgtgtcattccggctttcagatcttcggcggcggcgtgctcggcggtgcgcaggcc
gacctgctcgcggttcccgcagccgacttccaattgctcaagatgcccgaggggatcagc
accgagcaggcgctactgctcaccgacaacctggccaccggctgggcagcagcgcagcgc
gcagacatcccgttcggcggcaccgtcgcggtcatcggcctgggcgcggtcggactctgt
tcgctgcgcagcgcgttgttccatggcgctgcaacggttttcgcggtagatcaagttgac
ggccggttggaccgggccggccggtggggcgcgacgcccgtgaaagcgccagccatcgag
gcgatcctggcggcgacgggaggccggggcgccgacgcggtgatcgatgccgtcgccacg
gacgcctccctgaccgaggcgatcaacaccgtacggcccggtggcaccgtctcggtggtc
ggtgtgcacgacatgaatccgttcccgctcaacgccttgggttgcctgattcgcagcacg
acggtgcgtttcactacggcgccggtgcagcgcacctggcccgagctgatcccgctgctg
cagtccggccgactcgacgtcgacggcatcttcaccaccacgcttccattggacgaggcg
gcgaagggctatgcgaccgccgagtcgcgttcgggcgacgacgtgaagatcctactgacg
ccctag

DBGET integrated database retrieval system