KEGG   Mycobacterium shigaense: MSG_03188Help
Entry
MSG_03188         CDS       T05717                                 

Definition
(GenBank) hypothetical protein
Organism
mshg  Mycobacterium shigaense
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP70 MreB_Mbl PepSY_TM
Motif
Other DBs
NCBI-ProteinID: BAX93326
UniProt: A0A1Z4EK82
LinkDB All DBs
Position
complement(3374658..3376451)
Genome map
AA seq 597 aa AA seqDB search
MADGATPALGLSIGATNLAAVTADHAVSRKPVLTLYQQRPPEVGVPSENPRLDEQGLVIT
GFVDRVGDPIGIVAADGSVHRSEVLLADALRALAYTANGNNTLPASLAVTHPAHWGTPAV
EALGSALSSVTEWSSPARPITLIPDAAATLFAVRANPGIPARGTVAVCDFGGSGTSITLM
DAAGDYRPLVPTVRHQDFCGDLIDQAVLTAVLANVPSTGGFDPSGTSAIGSLSRLRVACR
VAKEQLSSSTATTLATELPGVGGDVRLTRNELDDAIRDSLSNFVSALDETLTRNAIRDLV
AVVSVGGGAHVPAVTTMLSGHFRVPVVTTLRPQLAAAIGAALRASRGPGDTSATALTPAA
PLGAASAAAPIVPVAPLAVEEGNSARTQIRSAEPVSSMMPVLAWSEADDNSRGMPAGSGY
TSARPALNFEANAESRREKRRNSILPWHRLPGIVGLGTAVAVLLVGIAVAIGFSGDKAVT
NPAPGANSPAAPAPASAGAPQSAPANPAPPSAPPQVAPQVAPAQPADAGPPPADIPPPPA
DIPQPPADVPAPPQAPPPPVPQLPQAPPVPPRIPIPAIPPIPHIPGINLSIPGIGHS
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atggcagacggagctacgcccgcgcttgggctctcgatcggcgctaccaacctggcagcc
gtcaccgcagatcacgccgtttcacgcaagcccgtcctgacgctgtatcagcagcgcccg
cccgaggtcggcgtgccgtcggagaacccgaggctggacgaacagggcctggtgatcacc
ggctttgtggaccgggtcggcgacccgatcggcatcgtggcggccgacggctcggtgcat
cgcagcgaggtcctgctggccgacgcgctgcgcgcactggcctacaccgcgaacggcaac
aacaccctgcccgcaagcctcgccgtcacccaccccgcgcactggggaactcccgcggtg
gaggcactcggttcggcgctgagcagcgtgaccgaatggtcgagcccggcgcgacccatc
accttgatcccggacgcagcggcgacgctgttcgccgtgcgggcgaacccgggcataccg
gcgcgcggcaccgtcgcggtgtgcgacttcggcggcagcggaacgagcatcacgttgatg
gacgcggccggcgactatcggccgttggtgccgactgtgcggcatcaggacttctgcggc
gacctgatcgatcaggcggtgttgacggccgtgctggccaacgtgccgagcaccggggga
ttcgacccgtccggcacgtcggcgatcggttcgctgagccggctgcgtgttgcctgccga
gtcgcgaaggaacaactgtcgtcgagtaccgcgaccacgctggccacggagctacccggc
gtgggcggcgatgtccggctcacccgaaacgaactcgacgacgcgatccgtgactcgctg
agtaatttcgtctcggccttggatgagacgttgacgcgcaacgcaattcgcgatctcgtc
gcggtggtgtcggtgggcggcggggcgcacgtcccggcggtcaccacgatgctgtcggga
catttccgggtccccgtggtcacgacgctgcgcccccagctggccgcggcgatcggggcc
gcattgcgggcgtcccgagggccgggcgatacgagtgccacggccctgacgccggccgcg
ccgcttggtgcggcctcggccgcggcgccgatcgtgccggtggcgccactggcggtggaa
gaggggaattccgcgcggacccagatccggtcggccgagccggtgtcgagcatgatgccg
gtgctggcgtggtcggaggccgacgacaattcgcgcggtatgccggccgggtcgggctac
acgtcggcgcgcccggcgctgaacttcgaagccaacgccgagtcgcgtcgggagaagaga
aggaactcgatcctgccgtggcatcggctgcccgggatcgtggggctcgggacggcggtc
gccgtgctgctggtcggcatcgcggtggcgatcggattttccggcgacaaggccgtcacg
aacccggcaccgggcgcgaactcgccggccgctcccgcaccggccagcgccggcgcgccg
cagtccgcacccgcgaatcccgcgccgccgtcggcgccacctcaggtggcaccgcaagtt
gcgcccgcccaacccgcggatgcgggaccacccccggcggacatcccgccgcccccggcg
gacatcccgcagcctcccgcggatgttcccgcgccgccgcaggcacccccgccgccggta
cctcagctgccgcaggcaccgccggtgccgccgcgcatcccgatcccggcgattccgccc
atcccacacatccccggaatcaacttgtcaattccggggattgggcacagctag

DBGET integrated database retrieval system