KEGG   Mycobacterium shigaense: MSG_04757Help
Entry
MSG_04757         CDS       T05717                                 

Definition
(GenBank) putative aldehyde dehydrogenase
Organism
mshg  Mycobacterium shigaense
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: BAX94867
UniProt: A0A1Z4EPE8
LinkDB All DBs
Position
complement(5004781..5006232)
Genome map
AA seq 483 aa AA seqDB search
MYERDELFIDGKWAAPQSESVIVVVSPHSEAVIGRAACAGPMDVNRAIGAARAAFDTGPW
PRMRPAERVEALGRLAAIYQERRAEMAELISAEIGAPISFAKMAQVRLPLTMISVFCGLA
ADYQWSQERLGLYGNNIRIAKRPVGVVAAIVPWNMPQFLTVTKVVPALLAGCSVVLKPAP
ESVLDAQLLAELVAAADLPPGVLNVVPGGRQVGELLVSHGGVDKVSFTGSTAAGRQVARA
CADGLRQVSLELGGKSAAVVLDDADPAATATGIQMASLANSGQVCNALSRILVPESRKDE
FVDALAAGMQAMTVGDPADPDTQIGPLVAQRQQERVRGYIESGESEGARLVIGGADMPDG
LETGWYVRPTLFSEASNDMRIAREEIFGPVLTVISYRDEDEAIRIANDSEYGLAGSVFTA
DVERGYGVAARVRSGTFGVNEGYIMDPAAPFGGVKNSGYGRELGPEGIDSYTVSQSISVA
AGH
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgtacgagagagacgaactcttcatcgacggcaagtgggcggcaccgcaatccgagtcg
gtcatcgtggtggtgtcgccgcacagcgaagcggtgatcggccgcgccgcgtgcgcggga
cccatggatgtgaatcgggctatcggggccgcccgggccgccttcgataccgggccgtgg
ccgcgcatgcggccggccgaacgcgtcgaggcgctgggccggctggccgcgatctatcag
gagcgccgggccgagatggccgagctgatctccgcggagatcggggctccgatcagcttc
gccaaaatggcgcaggtgcgcctgccgttgaccatgatctcggttttttgcggcctggcg
gccgattaccagtggtcccaagagcgactgggattgtacggcaacaacattcggatcgcc
aagcggccggtgggagtcgtcgccgcgatcgtcccgtggaacatgccgcagttcctcacc
gtgaccaaggtggtgccggcgctgctggcgggatgttcggtggtactcaagcccgcgccg
gagtcggtgctcgacgcgcagttgctggccgagctggtcgccgcggccgatctacctccc
ggtgtgctcaacgtggtgcccggcggccgccaggtcggcgaacttctggtcagccacggc
ggtgtggacaaagtgtcgttcaccggctccaccgcggccggacgccaggtcgcccgcgcg
tgcgccgacggactcaggcaggtgagcctcgaattgggcggcaagtccgcggcggtcgtg
ctcgacgacgccgaccccgcggcgacggccaccgggatccagatggccagcctggccaac
agcggacaggtgtgcaacgcgctcagccgcatcctcgtgcccgagtcacgcaaggacgaa
ttcgtcgacgcgctggcggccgggatgcaggcgatgacggtgggcgacccggcggaccct
gacacccagatcggtccgctggtggcacagcgccaacaagagcgtgtacgcggctacatc
gaatcgggcgaaagcgagggagcccgcctggtgatcggtggtgcggacatgcccgacggc
ctcgaaaccggttggtacgtaaggccgacgctgttcagcgaggcaagcaacgacatgcgg
atcgcccgtgaggagatcttcggcccggtgctgaccgtcatctcctaccgcgacgaagac
gaggcgatccggatcgccaacgattccgagtacggtttggccggttcggtgttcaccgcc
gacgtcgagcgcggctacggcgtcgcggcccgggtacggtccggtaccttcggggtcaac
gagggctacatcatggatccggcggcgcccttcgggggtgtcaagaacagcggctacggt
cgtgaactcgggcccgagggcatcgacagttacacggtgagtcaatcgatttcggttgcc
gccgggcactga

DBGET integrated database retrieval system