KEGG   Mycobacterium shigaense: MSG_04764Help
Entry
MSG_04764         CDS       T05717                                 

Gene name
ligC
Definition
(GenBank) DNA ligase C
Organism
mshg  Mycobacterium shigaense
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: BAX94874
UniProt: A0A1Z4EPD4
LinkDB All DBs
Position
5011619..5012668
Genome map
AA seq 349 aa AA seqDB search
MPPVSPMLAKSVKTIPPDASYEPKWDGFRSICFRDGDDVELGSRNEKPMTRYFPELVAAV
QAELPRRCVIDGEIVIATDHGLDFEALQQRIHPAASRVRTLAEHTPAAFIVFDLLALGDD
DYTRRPFTERRAALVDALADSGPSIHLTPATTDLELAQLWFSEFEGAGLDGVVAKPLTIT
YQPDKRIMFKIKHERTADCVVAGYRVHKSGGDAIGSLLLGLYQDDGQLASVGVIGAFPMA
ERRRLFTELQPLVSDFDDHPWNWAAHQAGERTPRKNEYSRWNAGKDLSFVPLRPERVVEV
RYDHMEGRRFRHTAQFNRWRPDRNPRSCTYEQLEQPLTFSLGDIVPGLG
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgccgccggtttcgccgatgttggccaagtcggtcaagacgatcccgccggatgcgtcc
tatgagccgaagtgggacgggttccggtcgatctgcttccgggacggcgacgatgtcgag
ctgggcagccgcaacgaaaagccgatgacccgctactttcccgagctggtcgcggcggtg
caggccgagctgccgcggcggtgcgtgatcgacggcgagatcgtgatcgccaccgaccac
ggcctggatttcgaggcgctgcagcagcgcatccacccggccgcgtcgcgagtgcgcacg
ctcgccgaacacacgccggcggcgttcatcgtgttcgacctgctggccctgggcgacgac
gactacacccggcggccgttcaccgagcgccgcgccgccctggtcgacgccctggccgac
tcgggaccgtcgatacacctcaccccggccaccacggatctcgaactggcgcagctgtgg
ttctccgagttcgagggcgccgggctcgacggcgtcgtcgccaagccgctgactatcacc
taccagccggacaagcgaatcatgttcaagatcaagcacgaacgcaccgccgactgtgtg
gtagccgggtaccgcgtgcacaagtccggcggtgacgccatagggtcgctgctgctcggg
ctgtaccaggacgacggtcagctcgcctcggtcggcgtcatcggcgccttcccgatggcc
gaacgccggcgactgttcaccgaattgcagccgctggtctccgatttcgacgaccatccg
tggaattgggccgcgcatcaggccggcgagcgcaccccgcgcaagaacgaatactcgcgg
tggaacgcaggcaaggatctgtcgttcgtcccgctgcgacccgagcgggtggtcgaggtc
cgctacgaccacatggagggccggcggttccgccacaccgcgcaattcaaccggtggcgc
ccggaccgcaacccgcgctcatgcacctacgagcaactcgagcagccgctgactttcagt
ttgggcgacatcgtgcccggcctgggctag

DBGET integrated database retrieval system