KEGG   Mycobacterium shigaense: MSG_04904Help
Entry
MSG_04904         CDS       T05717                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
mshg  Mycobacterium shigaense
Brite
Enzymes [BR:mshg01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     MSG_04904
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: BAX95010
UniProt: A0A1Z4EQ25
LinkDB All DBs
Position
5146157..5146780
Genome map
AA seq 207 aa AA seqDB search
MAEYTLPDLDWDYAALEPHISGQINEIHHTKHHATYVKGLNDAVAKLEEARANGDHSAIF
LNEKNLAFHLGGHVNHSIWWKNLSPDGGDKPTGALGAAIDEQFGSFDKFQAQFSAAANGL
QGSGWAVLGYDSLGDRLLTFQLYDQQANVPLGIIPLLQVDMWEHAFYLQYKNVKADYVKA
FWNVVNWPDVQSRYEAATSKTNGLIFG
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
gtggctgaatacaccctgcccgatttggactgggactacgcagcgctggaaccgcacatt
tccgggcagatcaacgagatccaccacaccaagcaccacgccacctacgtcaaaggcctc
aacgacgcggtggccaagctggaggaagcccgggccaacggcgaccactccgcgatcttc
ctgaacgagaagaacctggccttccacctgggcggccacgtcaaccacagcatctggtgg
aagaacctgtcgccggacggcggcgacaagcccaccggcgccctgggcgccgcgatcgac
gagcagttcggatcgttcgacaagttccaggctcagttcagcgctgccgccaacggtttg
cagggatcgggttgggcggtgctgggttacgacagcctcggcgaccggctgttgaccttc
cagctctacgaccagcaggccaacgtcccgctcggcatcattccgttgctccaggtcgac
atgtgggagcacgccttctacctgcagtacaaaaacgtcaaggcggactacgtcaaggcg
ttctggaatgtcgtcaactggccggacgtccagtcacgatatgaagccgcgacgtcgaaa
accaacggtctgattttcggctga

DBGET integrated database retrieval system