KEGG   Methanobrevibacter smithii: Msm_0565Help
Entry
Msm_0565          CDS       T00539                                 

Definition
(GenBank) phosphate ABC transporter, ATPase component, PstB
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
msi  Methanobrevibacter smithii
Pathway
msi02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:msi00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Msm_0565
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:msi02000]
    Msm_0565
Enzymes [BR:msi01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     Msm_0565
Transporters [BR:msi02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    Msm_0565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_22 AAA_23 AAA_29 RsgA_GTPase NB-ARC AAA_16 AAA_15 AAA_25 Rad17 AAA_33 AAA_18 AAA AAA_24 Adeno_IVa2 AAA_5 AAA_30 RNA_helicase
Motif
Other DBs
NCBI-ProteinID: ABQ86770
UniProt: A5UKP2
LinkDB All DBs
Position
complement(541474..542223)
Genome map
AA seq 249 aa AA seqDB search
MKLEVRNLNTFFEDTQILKNVNMDVPENSVTALIGPSGCGKSTFIRTVNRMNDLIPTFSH
DGNISLDGVDVYDDAVDVVDLRKKVGMVFQKPNPFPKSIFDNVAYGLRIHGEEDEDYIAQ
VVEESLKSAAIWDEVKDKLDKSAMGLSGGQQQRLCIARTIAVSPEVILMDEPCSALDPIS
TLKIENLIHKLKEKYTIVMVTHNMQQATRVSKYTSFFLNGEIIESGLTDQIFVNPKEQKT
EEYITGRFG
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttgaagttagaaatttaaatacattttttgaggatactcagattttaaaaaat
gtaaatatggatgttccggagaattctgttactgcacttattgggccttcaggctgcggt
aaatctacattcatcagaacagttaatcgtatgaatgatttaattccaacattcagtcat
gacggtaatattagtttggatggtgtggatgtttatgatgatgctgtagatgttgttgat
ttaagaaaaaaagtaggtatggttttccaaaagccaaatccattcccaaaatctatattt
gacaatgttgcatacggattaagaattcatggagaagaagatgaagattatattgctcag
gtagttgaagaaagtctaaaatcagcagctatctgggatgaagttaaagataaattagat
aaatctgcaatgggtttgtctggtggtcagcaacaaagattatgtatagcacgtacaata
gctgttagtccggaagtaattttaatggatgagccttgttctgcgctggatccaatttcc
acattgaaaattgagaatttaattcataaacttaaagaaaagtatactattgttatggtt
acacataatatgcaacaggctacaagggtatctaaatacacttctttcttcttaaacgga
gaaataattgaaagcggtttaacagatcaaatatttgtaaatccgaaagaacaaaaaaca
gaagaatatattactggaagatttggttaa

DBGET integrated database retrieval system