KEGG   Methanosarcina siciliae C2J: MSSAC_0134
Entry
MSSAC_0134        CDS       T03863                                 

Definition
(GenBank) Proline reductase for pyrrolysine biosynthesis
  KO
K16182  3-methylornithyl-N6-L-lysine dehydrogenase [EC:1.4.1.-]
Organism
msj  Methanosarcina siciliae C2J
Pathway
msj00300  Lysine biosynthesis
msj01100  Metabolic pathways
msj01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:msj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    MSSAC_0134
Enzymes [BR:msj01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.-  
     MSSAC_0134
SSDB
Motif
Pfam: NAD_binding_2 UDPG_MGDP_dh_N Mur_ligase NAD_binding_7 3HCDH_N AlaDh_PNT_C 2-Hacid_dh_C Shikimate_DH
Other DBs
NCBI-ProteinID: AKB34724
UniProt: A0A0E3PIK8
LinkDB
Position
complement(162482..163261)
AA seq 259 aa
MALLTPEDLENINRQLQEADSTVRRVTGLDIKGVCKDFYGTTPCCEKVGIVPVTSGNGII
GNFSGSLHVITEYFGFDSFVTAMPDVSGYYEAVRNGARIILMADDNTFLAHNLKNGKIAN
NQPCTGRIYAEIASRYLKADSKDVLVVGLGKVGFPGAAHLVNKGFRVYGYDSDKALLEKT
VSDLGITLFEPENPRKFSIIFEATPCADTVPEFVISENCVISTPGIPCAISRELQEKYGV
ELVMEPLGIGTASMLYSVL
NT seq 780 nt   +upstreamnt  +downstreamnt
atggcacttttaaccccggaagacctggaaaacattaacagacagcttcaggaagctgat
tctactgtacggagagttacagggcttgacataaaaggagtctgcaaagacttctacggc
acgaccccatgctgtgaaaaagtaggcatcgtacctgtgacctcgggaaacgggatcata
ggaaatttctcgggatccctgcatgtaattaccgaatatttcggatttgacagctttgtt
acggctatgcctgatgttagcgggtactatgaagccgtaaggaacggagcccggattatc
cttatggcggacgataataccttccttgcccataacctcaaaaacgggaaaatagctaat
aaccagccctgcacaggcagaatttatgcggaaatagcctccagatatctgaaagccgat
tcaaaggacgtgcttgtcgttggactggggaaggtaggctttccgggagcagcgcatctc
gtaaataagggtttcagggtctatggatatgattctgacaaagctcttttagaaaaaact
gtttctgaccttggaattactctttttgaacccgaaaacccgagaaaattttccattatt
ttcgaggcaaccccctgtgcggatacggttcccgaattcgtaatttcggagaactgcgta
atttccacacccggaatcccctgcgcaatttccagggagcttcaagagaagtatggggtg
gaacttgtaatggaacctctcgggataggaacagcatccatgctgtattctgtcctgtaa

DBGET integrated database retrieval system