KEGG   Methanosarcina siciliae C2J: MSSAC_4246Help
Entry
MSSAC_4246        CDS       T03863                                 

Definition
(GenBank) Ribulose-1,5-bisphosphate carboxylase, Type III
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
msj  Methanosarcina siciliae C2J
Pathway
msj00630  Glyoxylate and dicarboxylate metabolism
msj01100  Metabolic pathways
msj01120  Microbial metabolism in diverse environments
msj01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:msj00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MSSAC_4246
Enzymes [BR:msj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     MSSAC_4246
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AKB38836
UniProt: A0A0E3LED6
LinkDB All DBs
Position
5239757..5241043
Genome map
AA seq 428 aa AA seqDB search
MRRDYVDQGYSPKDTDLICEFHIEPAAGISFEEASTHMAGESSIDSWTEISTLSPELAAR
LKPHIFYLDANTQTVRVAYSEELFELGSVPQVLSAVAGNIFSMKIVDNLRLQDITFPKSM
LREFEGPNFGLPGVRDIVGVKDRPLVGTIVKPKVGLTSEMHAEVAYNAFAGGCDLVKDDE
NLTDQKFNGFEKRAELTLKIAEKAEAETGERKMYLCNITAPTCKEMVRRLHVLKDLGASY
AMIDIVPTGWTALQTLREAAADEGLALHAHRCMHSAFTRNPRHGVSMLLVAKLCRLIGLD
QLHIGTVVGKMHGDKNEVLSIRDECVLDTVPADPEQHVLAQDWGGLKPMFPVASGGLAPT
MIPDLYSIFGKEVIMQFGGGIHAHPMGTAAGAAACRQALEASLEGISLQDYAKDHKELEV
ALGKWLKK
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagggactacgtagaccagggctacagcccgaaagacacggatctgatctgtgaa
ttccatattgaaccggcagcaggaatcagttttgaggaagcttccacccatatggcaggg
gaaagctccatcgattcctggactgaaatttccactcttagccccgagcttgcagccagg
ttgaaacctcacatcttttacctggatgcaaatacccaaacggtccgggtggcttattcc
gaggagctcttcgaactcgggtccgtcccccaggtcctgagcgcggtggcgggcaacatt
ttcagcatgaagattgtggacaacctgcgtctgcaggatatcaccttcccgaaatccatg
ctccgggagtttgagggaccgaacttcgggcttcccggggtccgggatatcgttggggtt
aaagacaggccccttgtagggacaatcgtcaagcctaaggtcggcctgacctcggaaatg
catgctgaagttgcatacaatgcttttgccgggggctgcgaccttgtaaaggacgacgag
aaccttactgaccagaagttcaacggatttgaaaagagggcggaactcaccctgaaaatt
gcggaaaaagcggaagcagaaaccggggagcggaaaatgtacctgtgcaatatcacggct
cctacctgcaaggaaatggtacggcgcctgcacgtgctaaaggatctcggggcaagttac
gccatgatcgacatcgtgcccacgggctggacagccctccagaccctccgggaagcagcc
gcagatgaaggcctggcgctccacgcccaccgttgcatgcattcggcattcacaaggaac
ccgaggcacggggtcagtatgctgctcgtggccaaactctgccggctgatcgggcttgac
cagctccatatcggtaccgttgtcgggaagatgcacggggataagaacgaagtcctttcg
atcagggacgaatgtgtgctcgataccgtacccgcagatccagaacagcatgtccttgcc
caggactggggagggctaaaaccgatgtttccggtagcatccggagggcttgcccctaca
atgattcctgacctttactctattttcggaaaagaagtcattatgcagttcggcggagga
atccatgctcacccgatgggcacggcagccggagccgctgcctgcaggcaggcccttgaa
gcaagccttgaaggcatcagcctgcaggactatgctaaggaccacaaagaacttgaagtt
gctctcgggaaatggctgaagaaataa

DBGET integrated database retrieval system