KEGG   Methylocella silvestris: Msil_0521Help
Entry
Msil_0521         CDS       T00802                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
msl  Methylocella silvestris
Pathway
msl00010  Glycolysis / Gluconeogenesis
msl00020  Citrate cycle (TCA cycle)
msl00620  Pyruvate metabolism
msl01100  Metabolic pathways
msl01110  Biosynthesis of secondary metabolites
msl01120  Microbial metabolism in diverse environments
msl01130  Biosynthesis of antibiotics
msl01200  Carbon metabolism
Module
msl_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:msl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Msil_0521
   00020 Citrate cycle (TCA cycle)
    Msil_0521
   00620 Pyruvate metabolism
    Msil_0521
Enzymes [BR:msl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Msil_0521
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: ACK49493
UniProt: B8EJT9
LinkDB All DBs
Position
579286..580620
Genome map
AA seq 444 aa AA seqDB search
MPVNILMPALSPTMEKGNLSRWLKKEGDKIKSGDVIAEIETDKATMEVEAVDEGVLARIV
VPDGTADVAVNDVIGVIAADGEDVSAAAAPAAAKPAPAAPASAAPASAPSAPAASAAQTA
PAPAAVNGQAGPRLFASPLARRIAKESGLDLSGVAGSGPHGRIVERDVKAALAQPRPQIA
KAPAAPAAPSPAAPTPAPASDEAIRKFYAPGSYDEAPHDSMRKTIARRLVEASQTIPHFY
LSVDCNLDALLALRETVNAQASRDKDAKPSYKISVNDFIIKGLALALIRVPEANVTWTES
VMLKHKHADVGVAVSIPGGLITPVIRSADTKSLSAISNEMKDYAARAKARKLKPEEYQGG
SSSVSNLGMFGIKNFSAIINPPQSSILAVGAGEKRVVVKDGAPAVATLMSVTLSTDHRAV
DGALGAELLDAFKSLIEHPMSMLV
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtcaacatcctgatgcccgccctttcgccgaccatggaaaaaggcaatctcagc
cgatggttgaagaaagaaggcgacaagatcaaatccggcgacgtcatcgctgaaatcgag
accgacaaggcgacgatggaggtcgaggcggtggacgaaggcgttctcgccaggatcgtc
gtccccgatggcaccgccgacgtcgccgtgaacgacgtgatcggggtcatcgccgccgat
ggagaggacgtatcggccgccgcggcccctgccgccgccaaacccgcgcccgcggcgccc
gcgtctgccgcgccagcttccgccccgtccgcgcccgctgcatccgcagcgcaaacggct
ccggcgcccgccgccgtcaacgggcaggcggggccgcgcctgttcgcctcgccgctcgcg
cgccgcatcgccaaggagtcggggctcgatctctccggcgtcgccggctcaggtccgcat
ggccgcatcgtcgagcgcgacgtcaaggcggcgctggcccagccaagaccgcaaatcgcc
aaggcgccggcggcgcccgccgcgccgtctccggccgcgccgactcccgccccggcgtcg
gatgaagccatccgcaaattctatgcgccaggctcctatgacgaggcgccgcatgattca
atgcgcaagacaattgcgaggcgccttgtcgaagcgagccagacgatcccgcatttctat
ctgtcggtcgactgcaatctcgacgctctgctggcgttgcgcgagacggtgaacgcgcag
gcctctcgcgacaaggacgccaagccctcttacaaaatctcggtcaatgatttcatcatc
aaggggctcgctctggcgttgatccgcgtgccggaagccaatgtcacctggaccgaatcg
gtcatgctgaagcacaagcatgccgatgtcggcgtcgccgtctcaattcctggcggcctc
atcacgccggttatccgttcggccgacacgaagtcgctgtcggcgatttcgaacgagatg
aaggattatgcggcgcgggccaaggcgcggaaactgaagccggaggaatatcagggcggc
tcctcctcggtgtcgaacctcggcatgttcggcatcaagaatttttccgccatcatcaac
cccccgcaatcctcgatcctcgcggtcggggcgggcgagaagcgcgtcgtcgtcaaggac
ggcgcgccggcggtggcgacgttgatgagcgtcacgctctcgaccgatcatcgcgcggtc
gatggggcgcttggcgccgagctgctcgacgccttcaaatccctgattgagcatccgatg
tcgatgctcgtttga

DBGET integrated database retrieval system