KEGG   Methylocella silvestris: Msil_1003Help
Entry
Msil_1003         CDS       T00802                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
msl  Methylocella silvestris
Pathway
msl00061  Fatty acid biosynthesis
msl00780  Biotin metabolism
msl01100  Metabolic pathways
msl01130  Biosynthesis of antibiotics
msl01212  Fatty acid metabolism
Module
msl_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:msl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Msil_1003
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Msil_1003
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    Msil_1003
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:msl01004]
    Msil_1003
Enzymes [BR:msl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     Msil_1003
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     Msil_1003
Lipid biosynthesis proteins [BR:msl01004]
 Fatty acid synthase
  Component type
   Msil_1003
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: ACK49972
UniProt: B8EK25
LinkDB All DBs
Position
complement(1088460..1089308)
Genome map
AA seq 282 aa AA seqDB search
MTQPEAMTDDLIRSGPLAGKRGLILGLANNRSIAWGIAKAARDAGAELAFTFQGESLGKR
VRPLAAELGGVVVGHCDVTDAASLDAVFGEIERSWGKLDFVVHCVAFSDKDELTGRYVNT
TAENFSNTLLVSCYSFTAIAQRAERLMPDGGSLLTLTYYGAEKWMPHYNVMGVAKAALEA
SVRYLAADLGEKNIRVNAISAGPIKTLAASGIGDFRYILKWNEYNAPLRRSVSIEEVGES
AVFLLSSMARGVTGEILHVDAGYHIVGMKNPAAPDIGALGKE
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaaccggaagctatgacagatgatctgatccggtccggcccgcttgcgggcaag
cgcggcctcattcttggcctcgccaataatcggtcgatcgcctgggggatcgccaaggcg
gcgcgcgacgccggggcggaactcgctttcacctttcagggcgagtcgctcggcaagagg
gtgcgcccgctcgcggccgaacttggcggcgtggtcgtcggccattgcgacgtgaccgac
gccgcaagtcttgacgccgtcttcggcgagatcgagcgcagctggggcaagctcgacttt
gtcgttcattgcgtcgccttctccgataaggacgagctgaccgggcgctatgtcaacacg
acggcggaaaatttcagcaatacgctgctggtctcctgctattccttcaccgctatcgcg
cagcgggccgaacggctgatgccggatggcgggtcgctgttgaccctgacctattacggc
gccgaaaaatggatgccgcattataatgtgatgggcgtcgccaaggccgcgcttgaagcc
agcgtgcgctatcttgcggccgacctcggcgagaagaatatccgcgtcaacgccatttcg
gcaggtcccatcaagacgcttgcagcctcggggattggcgatttccgctatattttgaag
tggaacgaatataacgcgccgctgcgccgctccgtctctatcgaggaagtgggcgaaagc
gccgtcttcctgctctcgtccatggcgcgcggggtgacgggcgaaattctccatgtcgac
gccggctatcatattgtcggaatgaagaatcctgccgcgcccgacatcggcgcgctgggc
aaggagtaa

DBGET integrated database retrieval system